Overview

  • Product name

  • Description

    Rabbit polyclonal to CIA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human CIA aa 112-283.
    Sequence:

    DMRDSRDPMYRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPE SQSRAKERLKREERRREELYRQYFEEIQRRFDAERPVDCSVIVVNKQTKD YAESVGRKVRDLGMVVDLIFLNTEVSLSQALEDVSRGGSPFAIVITQQHQ IHRSCTVNIMFGTPQEHRNMPQ


    Database link: Q9HCD5

  • Positive control

    • WB: HeLa, HEK-293 and MCF7 whole cell lysate; Mouse heart and liver tissue lysate. ICC/IF: MCF7 cells.
  • General notes

    Protein previously labeled as NCOA5.

Properties

Applications

Our Abpromise guarantee covers the use of ab236914 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000.
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    CIA is a nuclear receptor coregulator that can have both coactivator and corepressor functions. It interacts with nuclear receptors for steroids (ESR1 and ESR2) independently of the steroid binding domain (AF2) of the ESR receptors, and with the orphan nuclear receptor NR1D2. It Is also involved in the coactivation of nuclear steroid receptors (ER) as well as the corepression of MYC/c myc in response to 17 beta estradiol (E2).
  • Cellular localization

    Nuclear
  • Database links

  • Alternative names

    • bA465L10.6 antibody
    • CIA antibody
    • Coactivator independent of AF 2 antibody
    • KIAA1637 antibody
    • MGC28864 antibody
    • NCoA 5 antibody
    • NCOA5 antibody
    • Nuclear receptor coactivator 5 antibody
    • OTTMUSP00000001057 antibody
    • RP23-61O3.13 antibody
    see all

Images

  • All lanes : Anti-CIA antibody (ab236914) at 1/1000 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : HEK-293 (human epithelial cell line from embryonic kidney) whole cell lysate
    Lane 3 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 4 : Mouse heart tissue lysate
    Lane 5 : Mouse liver tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
  • MCF7 (human breast adenocarcinoma cell line) cells stained for CIA (green) using ab236914 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

References

ab236914 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236914.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up