Overview

  • Product name

  • Description

    Rabbit polyclonal to CIAPIN1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human CIAPIN1 aa 4-93.
    Sequence:

    FGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQS AHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCL


    Database link: Q6FI81

  • Positive control

    • IHC: Human urinary bladder tissue. WB: RT4 cell lysate. ICC/IF: A431 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab224172 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 34 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeablization: PFA/Triton X-100.

Target

  • Function

    May be required for the maturation of extramitochondrial Fe/S proteins (By similarity). Has anti-apoptotic effects in the cell. Involved in negative control of cell death upon cytokine withdrawal. Promotes development of hematopoietic cells.
  • Tissue specificity

    Ubiquitously expressed. Highly expressed in heart, liver and pancreas.
  • Sequence similarities

    Belongs to the anamorsin family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2810413N20Rik antibody
    • Anamorsin antibody
    • CIAPIN 1 antibody
    • CIAPIN1 antibody
    • CPIN1_HUMAN antibody
    • Cytokine induced apoptosis inhibitor 1 antibody
    • Cytokine-induced apoptosis inhibitor 1 antibody
    • DRE2 antibody
    • Fe-S cluster assembly protein DRE2 homolog antibody
    • Predicted protein of HQ0915 antibody
    • PRO0915 antibody
    see all

Images

  • Anti-CIAPIN1 antibody (ab224172) at 1/100 dilution + RT4 (human urinary bladder cancer cell line) cell lysate

    Predicted band size: 34 kDa

  • Paraffin-embedded human urinary bladder tissue stained for CIAPIN1 using ab224172 at 1/50 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for CIAPIN1 (green) using ab224172 at 4 µg/ml in ICC/IF.

References

ab224172 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224172.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up