Anti-CIB1/KIP antibody (ab220606)
Key features and details
- Rabbit polyclonal to CIB1/KIP
- Suitable for: ICC/IF, WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-CIB1/KIP antibody
See all CIB1/KIP primary antibodies -
Description
Rabbit polyclonal to CIB1/KIP -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Sheep, Cow -
Immunogen
Recombinant fragment corresponding to Human CIB1/KIP aa 105-187.
Sequence:DIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMKQLID NILEESDIDRDGTINLSEFQHVISRSPDFASSF
Database link: Q99828 -
Positive control
- WB: RT-4 cell lysate. ICC/IF: A549 cells.
-
General notes
This product was previously labelled as CIB1
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab220606 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 22 kDa. |
Target
-
Function
May convert the inactive conformation of integrin alpha-IIb/beta3 to an active form through binding to the integrin cytoplasmic domain. Induces cell migration and spreading mediated through integrin (possibly via focal adhesion complexes). Functions as a negative regulator of stress activated MAP kinase (MAPK) signaling pathways. May play a role in regulation of apoptosis. Interacts with and up-regulates PTK2 activity. Down regulates inositol 1,4,5-trisphosphate receptor-dependent calcium signaling. -
Tissue specificity
Ubiquitous. -
Sequence similarities
Contains 2 EF-hand domains. -
Cellular localization
Membrane. Cytoplasm. Nucleus. Cell projection > filopodium. Apical cell membrane. Localizes to the perinuclear region in the presence of NBR1. Colocalizes with TAS1R2 in apical regions of taste receptor cells. - Information by UniProt
-
Database links
- Entrez Gene: 10519 Human
- Entrez Gene: 23991 Mouse
- Entrez Gene: 81823 Rat
- Omim: 602293 Human
- SwissProt: Q99828 Human
- SwissProt: Q9Z0F4 Mouse
- SwissProt: Q9R010 Rat
- Unigene: 715556 Human
see all -
Alternative names
- Calcium and integrin binding 1 (calmyrin) antibody
- Calcium and integrin binding protein 1 antibody
- Calcium and integrin-binding protein 1 antibody
see all
Images
-
Anti-CIB1/KIP antibody (ab220606) at 1/2500 dilution + RT-4 cell lysate
Predicted band size: 22 kDa -
Immunofluorescent analysis of PFA fixed, triton X-100 permeabilized A549 cells labeling CIB1/KIP with ab220606 at 4 µg/mL (green).
Protocols
Datasheets and documents
References (0)
ab220606 has not yet been referenced specifically in any publications.