Anti-CIB1/KIP antibody (ab220606)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-CIB1/KIP antibody
See all CIB1/KIP primary antibodies -
Description
Rabbit polyclonal to CIB1/KIP -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse, Rat, Sheep, Cow
-
Immunogen
Recombinant fragment corresponding to Human CIB1/KIP aa 105-187.
Sequence:DIKSHYAFRIFDFDDDGTLNREDLSRLVNCLTGEGEDTRLSASEMKQLID NILEESDIDRDGTINLSEFQHVISRSPDFASSF
Database link: Q99828 -
Positive control
- WB: RT-4 cell lysate. ICC/IF: A549 cells.
-
General notes
This product was previously labelled as CIB1
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol, 59% PBS -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab220606 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| ICC/IF | Use a concentration of 1 - 4 µg/ml. Fixation/Permeabilization: PFA/Triton X-100. |
|
| WB | 1/2500 - 1/5000. Predicted molecular weight: 22 kDa. |
Target
-
Function
May convert the inactive conformation of integrin alpha-IIb/beta3 to an active form through binding to the integrin cytoplasmic domain. Induces cell migration and spreading mediated through integrin (possibly via focal adhesion complexes). Functions as a negative regulator of stress activated MAP kinase (MAPK) signaling pathways. May play a role in regulation of apoptosis. Interacts with and up-regulates PTK2 activity. Down regulates inositol 1,4,5-trisphosphate receptor-dependent calcium signaling. -
Tissue specificity
Ubiquitous. -
Sequence similarities
Contains 2 EF-hand domains. -
Cellular localization
Membrane. Cytoplasm. Nucleus. Cell projection > filopodium. Apical cell membrane. Localizes to the perinuclear region in the presence of NBR1. Colocalizes with TAS1R2 in apical regions of taste receptor cells. - Information by UniProt
-
Database links
- Entrez Gene: 10519 Human
- Entrez Gene: 23991 Mouse
- Entrez Gene: 81823 Rat
- Omim: 602293 Human
- SwissProt: Q99828 Human
- SwissProt: Q9Z0F4 Mouse
- SwissProt: Q9R010 Rat
- Unigene: 715556 Human
see all -
Alternative names
- Calcium and integrin binding 1 (calmyrin) antibody
- Calcium and integrin binding protein 1 antibody
- Calcium and integrin-binding protein 1 antibody
see all
Images
-
Western blot - Anti-CIB1/KIP antibody (ab220606)Anti-CIB1/KIP antibody (ab220606) at 1/2500 dilution + RT-4 cell lysate
Predicted band size: 22 kDa -
Immunocytochemistry/ Immunofluorescence - Anti-CIB1/KIP antibody (ab220606)Immunofluorescent analysis of PFA fixed, triton X-100 permeabilized A549 cells labeling CIB1/KIP with ab220606 at 4 µg/mL (green).
Datasheets and documents
References
ab220606 has not yet been referenced specifically in any publications.
