Overview

  • Product name
  • Description
    Mouse polyclonal to CIKS
  • Host species
    Mouse
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Full length protein within Human CIKS aa 1-565. The exact sequence is proprietary. Isoform 2 (NP_679211.1)
    Sequence:

    MNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAP TMLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHP GLGKAFPSGCSAVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASP DTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYD SQPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQM LPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQPALPGQPLP GASVRGLHPVQKVILNYPSPWDQEERPAQRDCSFPGLPRHQDQPHHQPPN RAGAPGESLECPAELRPQVPQPPSPAAVPRPPSNPPARGTLKTSNLPEEL RKVFITYSMDTAMEVVKFVNFLLVNGFQTAIDIFEDRIRGIDIIKWMERY LRDKTVMIIVAISPKYKQDVEGAESQLDEDEHGLHTKYIHRMMQIEFIKQ GSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLREEEYV APPRGPLPTLQVVPL


    Database link: O43734-2

  • Positive control
    • CIKS transfected 293T lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab172509 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 65 kDa.

Target

  • Function
    Could be involved in the activation of both NF-kappa-B via a NF-kappa-B inhibitor kinase (IKK)-dependent mechanism and stress-activated protein kinase (SAPK)/JNK.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Contains 1 SEFIR domain.
  • Information by UniProt
  • Database links
  • Alternative names
    • Act 1 antibody
    • ACT1 antibody
    • Activator of cAMP responsive element modulator (CREM) in testis antibody
    • Adapter protein CIKS antibody
    • C6ORF4 antibody
    • C6ORF5 antibody
    • C6ORF6 antibody
    • Chromosome 6 Open Reading Frame 4 antibody
    • Chromosome 6 Open Reading Frame 5 antibody
    • Chromosome 6 Open Reading Frame 6 antibody
    • CIKS_HUMAN antibody
    • Connection to IKK and SAPK / JNK antibody
    • Connection to IKK and SAPK/JNK antibody
    • Nuclear Factor Kappa B Activator 1 antibody
    • Nuclear factor NF kappa B activator 1 antibody
    • Nuclear factor NF-kappa-B activator 1 antibody
    • TRAF3 interacting protein 2 antibody
    • TRAF3-interacting protein 2 antibody
    • TRAF31P2 antibody
    • TRAF3IP2 antibody
    see all

Images

  • All lanes : Anti-CIKS antibody (ab172509) at 1 µg/ml

    Lane 1 : CIKS transfected 293T lysate
    Lane 2 : Non-transfected 293T lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 65 kDa

References

ab172509 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172509.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up