Overview

  • Product name

  • Description

    Mouse polyclonal to CIKS/ACT1
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Full length protein within Human CIKS/ACT1 aa 1-565. The exact sequence is proprietary. Isoform 2 (NP_679211.1)
    Sequence:

    MNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAP TMLHNSSGDFSQAHSTLKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHP GLGKAFPSGCSAVSEPASESVVGALPAEHQFSFMEKRNQWLVSQLSAASP DTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYD SQPQDVLGIRQLERPLPLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQM LPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQPALPGQPLP GASVRGLHPVQKVILNYPSPWDQEERPAQRDCSFPGLPRHQDQPHHQPPN RAGAPGESLECPAELRPQVPQPPSPAAVPRPPSNPPARGTLKTSNLPEEL RKVFITYSMDTAMEVVKFVNFLLVNGFQTAIDIFEDRIRGIDIIKWMERY LRDKTVMIIVAISPKYKQDVEGAESQLDEDEHGLHTKYIHRMMQIEFIKQ GSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLREEEYV APPRGPLPTLQVVPL


    Database link: O43734-2

  • Positive control

    • CIKS/ACT1 transfected 293T lysate
  • General notes

     This product was previously labelled as CIKS

     

Properties

Applications

Our Abpromise guarantee covers the use of ab172509 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 65 kDa.

Target

  • Function

    Could be involved in the activation of both NF-kappa-B via a NF-kappa-B inhibitor kinase (IKK)-dependent mechanism and stress-activated protein kinase (SAPK)/JNK.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Contains 1 SEFIR domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Act 1 antibody
    • ACT1 antibody
    • Activator of cAMP responsive element modulator (CREM) in testis antibody
    • Adapter protein CIKS antibody
    • C6ORF4 antibody
    • C6ORF5 antibody
    • C6ORF6 antibody
    • Chromosome 6 Open Reading Frame 4 antibody
    • Chromosome 6 Open Reading Frame 5 antibody
    • Chromosome 6 Open Reading Frame 6 antibody
    • CIKS_HUMAN antibody
    • Connection to IKK and SAPK / JNK antibody
    • Connection to IKK and SAPK/JNK antibody
    • Nuclear Factor Kappa B Activator 1 antibody
    • Nuclear factor NF kappa B activator 1 antibody
    • Nuclear factor NF-kappa-B activator 1 antibody
    • TRAF3 interacting protein 2 antibody
    • TRAF3-interacting protein 2 antibody
    • TRAF31P2 antibody
    • TRAF3IP2 antibody
    see all

Images

  • All lanes : Anti-CIKS/ACT1 antibody (ab172509) at 1 µg/ml

    Lane 1 : CIKS/ACT1 transfected 293T lysate
    Lane 2 : Non-transfected 293T lysate

    Lysates/proteins at 15 µl per lane.

    Developed using the ECL technique.

    Predicted band size: 65 kDa

References

ab172509 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172509.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up