Overview

  • Product name

  • Description

    Rabbit polyclonal to Cingulin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Cingulin aa 92-252.
    Sequence:

    LELPENPYSQVKGFPAPSQSSTSDEEPGAYWNGKLLRSHSQASLAGPGPV DPSNRSNSMLELAPKVASPGSTIDTAPLSSVDSLINKFDSQLGGQARGRT GRRTRMLPPEQRKRSKSLDSRLPRDTFEERERQSTNHWTSSTKYDNHVGT SKQPAQSQNLS


    Database link: Q9P2M7

  • Positive control

    • IHC-P: Human cervical cancer tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238116 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000.

Target

  • Function

    Probably plays a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier.
  • Tissue specificity

    Localized on the cytoplasmic face of tight junctions of polarized epithelia and some endothelia. Expressed in pancreas, kidney, liver and lung, but not in skeletal muscle, placenta, brain or heart.
  • Sequence similarities

    Belongs to the cingulin family.
  • Domain

    Deletion of the ZO-1 interaction motif (ZIM) decreases but does not abolish colocalization with ZO-1.
  • Cellular localization

    Cell junction > tight junction. Localizes to the apical junction complex composed of tight and adherens junctions.
  • Information by UniProt
  • Database links

  • Alternative names

    • 6330408J11Rik antibody
    • AI647528 antibody
    • AI987749 antibody
    • cgn antibody
    • CING_HUMAN antibody
    • Cingulin antibody
    • DKFZp779N1112 antibody
    • FLJ39281 antibody
    • KIAA1319 antibody
    • MGC118157 antibody
    see all

Images

  • Paraffin-embedded human cervical cancer tissue stained for Cingulin using ab238116 at 1/800 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab238116 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238116.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up