Overview

  • Product name

    Anti-CIP2A antibody [OTI9E6]
    See all CIP2A primary antibodies
  • Description

    Mouse monoclonal [OTI9E6] to CIP2A
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CIP2A aa 635-905. Produced in E.coli (NP_065941).
    Sequence:

    SKESRLQDLLETKALALAQADRLIAQHRCQRTQAETEARTLASMLREVER KNEELSVLLKAQQVESERAQSDIEHLFQHNRKLESVAEEHEILTKSYMEL LQRNESTEKKNKDLQITCDSLNKQIETVKKLNESLKEQNEKSIAQLIEKE EQRKEVQNQLVDREHKLANLHQKTKVQEEKIKTLQKEREDKEETIDILRK ELSRTEQIRKELSIKASSLEVQKAQLEGRLEEKESLVKLQQEELNKHSHM IAMIHSLSGGKINPETVNLSI


    Database link: Q8TCG1

  • Positive control

    • WB: HEK-293T cell lysate transfected with pCMV6-ENTRY CIP2A cDNA. IHC-P: Human lung carcinoma tissue.
  • General notes

    Clone OTI9E6 (formerly 9E6).

    Protein previously labeled as p90 Autoantigen.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Affinity purified
  • Purification notes

    Purified from cell culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    OTI9E6
  • Isotype

    IgG1
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab236506 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 102 kDa.
IHC-P 1/150.

Perform heat-induced epitope retrieval by Tris-EDTA, pH 8.0.

Target

  • Function

    Oncoprotein that inhibits PP2A and stabilizes MYC in human malignancies. Promotes anchorage-independent cell growth and tumor formation.
  • Tissue specificity

    Expressed at low levels in most of the tissues. Overexpressed in head-and-neck squamous cell carcinomas (HNSCC). Present in liver cancer cells (at protein level).
  • Cellular localization

    Membrane. Cytoplasm. Slightly concentrates in the perinuclear region.
  • Information by UniProt
  • Database links

  • Alternative names

    • Cancerous inhibitor of PP2A antibody
    • Cancerous Inhibitor of Protein Phosphatase 2A antibody
    • CIP2A antibody
    • CIP2A_HUMAN antibody
    • FLJ12850 antibody
    • Kiaa1524 antibody
    • MGC163436 antibody
    • p90 antibody
    • p90 autoantigen antibody
    • Protein CIP2A antibody
    see all

Images

  • All lanes : Anti-CIP2A antibody [OTI9E6] (ab236506) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cell lysate transfected with pCMV6-ENTRY CIP2A

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 102 kDa

  • Paraffin-embedded human lung carcinoma tissue stained for CIP2A using ab236506 at 1/150 dilution in immunohistochemical analysis.

References

ab236506 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236506.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up