Overview

  • Product name

    Anti-Citrate synthetase antibody
    See all Citrate synthetase primary antibodies
  • Description

    Rabbit polyclonal to Citrate synthetase
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ELISA, Dot blot, ICC/IFmore details
  • Species reactivity

    Reacts with: Pig
  • Immunogen

    Full length native protein (purified) corresponding to Pig Citrate synthetase aa 1-464.
    Sequence:

    MALLTAAARLFGAKNASCLVLAARHASASSTNLKDILADLIPKEQARIKT FRQQHGNTVVGQITVDMMYGGMRGMKGLVYETSVLDPDEGIRFRGYSIPE CQKMLPKAKGGEEPLPEGLFWLLVTGQIPTEEQVSWLSKEWAKRAALPSH VVTMLDNFPTNLHPMSQLSAAITALNSESNFARAYAEGIHRTKYWELIYE DCMDLIAKLPCVAAKIYRNLYREGSSIGAIDSKLDWSHNFTNMLGYTDAQ FTELMRLYLTIHSDHEGGNVSAHTSHLVGSALSDPYLSFAAAMNGLAGPL HGLANQEVLVWLTQLQKEVGKDVSDEKLRDYIWNTLNSGRVVPGYGHAVL RKTDPRYTCQ REFALKHLPHDPMFKLVAQLYKIVPNVLLEQGKAKNPW PNVDAHSGVLLQYYGMTEMNYYTVLFGVSRALGVLAQLIWSRALGFPLER PKSMSTDGLIKLVDSK


    Database link: P00889

Properties

Applications

Our Abpromise guarantee covers the use of ab182888 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration.
ELISA Use at an assay dependent concentration.
Dot blot Use at an assay dependent concentration.
ICC/IF Use at an assay dependent concentration.

Target

  • Pathway

    Carbohydrate metabolism; tricarboxylic acid cycle; isocitrate from oxaloacetate: step 1/2.
  • Sequence similarities

    Belongs to the citrate synthase family.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • CISY_HUMAN antibody
    • Citrate synthase antibody
    • Citrate synthase, mitochondrial antibody
    • citrate synthetase antibody
    • Cs antibody
    • EC 2.3.3 antibody
    • EC 2.3.3.1 antibody
    see all

References

ab182888 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182888.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up