Overview

  • Product name

    Anti-CKMT1B antibody
  • Description

    Rabbit polyclonal to CKMT1B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide within Human CKMT1B aa 130-180 conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary.
    Sequence:

    HNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPAC T


    Database link: P12532

  • Positive control

    • Human lung carcinoma tissue; mouse heart tissue; rat brain tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 0.01% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab204114 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/1000. Predicted molecular weight: 47 kDa.
IHC-P 1/100 - 1/500.

When using a fluorescent probe the recommended dilution is 1/50-1/200.

Target

  • Function

    Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.
  • Sequence similarities

    Belongs to the ATP:guanido phosphotransferase family.
    Contains 1 phosphagen kinase C-terminal domain.
    Contains 1 phosphagen kinase N-terminal domain.
  • Cellular localization

    Mitochondrion inner membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Acidic-type mitochondrial creatine kinase antibody
    • CKMT antibody
    • CKMT1 antibody
    • CKMT1B antibody
    • Creatine kinase mitochondrial 1 (ubiquitous) antibody
    • Creatine kinase mitochondrial 1B antibody
    • Creatine kinase U type mitochondrial antibody
    • Creatine kinase U-type antibody
    • KCRU_HUMAN antibody
    • Mia-CK antibody
    • mitochondrial antibody
    • U-MtCK antibody
    • Ubiquitous mitochondrial creatine kinase antibody
    • UMTCK antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human lung carcinoma tissue labeling CKMT1B with ab204114 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded mouse heart tissue labeling CKMT1B with ab204114 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat brain tissue labeling CKMT1B with ab204114 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab204114 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204114.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up