Anti-Claudin 4 antibody (ab217685)

Rabbit polyclonal Claudin 4 antibody. Validated in IHC and tested in Rat, Human. Immunogen corresponding to synthetic peptide.

Overview

  • Product name

  • Description

    Rabbit polyclonal to Claudin 4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Mouse
  • Immunogen

    Synthetic peptide within Human Claudin 4 aa 30-80 (internal sequence) conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    WRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQA A


    Database link: O14493

  • Positive control

    • Rat lung tissue, Human kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 1% BSA
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab217685 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/600. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Plays a major role in tight junction-specific obliteration of the intercellular space.
  • Involvement in disease

    Note=CLDN4 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region.
  • Sequence similarities

    Belongs to the claudin family.
  • Cellular localization

    Cell junction > tight junction. Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Claudin-4 antibody
    • Claudin4 antibody
    • CLD4_HUMAN antibody
    • CLDN 4 antibody
    • CLDN4 antibody
    • Clostridium perfringens enterotoxin receptor 1 antibody
    • Clostridium perfringens enterotoxin receptor antibody
    • CPE R antibody
    • CPE receptor antibody
    • CPE-R antibody
    • CPE-receptor antibody
    • CPER antibody
    • CPETR 1 antibody
    • CPETR antibody
    • CPETR1 antibody
    • hCPE R antibody
    • WBSCR8 antibody
    • Williams Beuren syndrome chromosome region 8 protein antibody
    • Williams-Beuren syndrome chromosomal region 8 protein antibody
    see all

Images

  • Immunohistochemical analysis of paraffin embedded Rat lung tissue, labeling Claudin 4 with ab217685 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of paraffin embedded Human kidney tissue, labeling Claudin 4 with ab217685 at 1/600 dilution, followed by conjugation to the secondary antibody and DAB staining.

     

References

ab217685 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217685.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up