Overview

  • Product name

  • Description

    Rabbit polyclonal to Claudin 9
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human Claudin 9 aa 172-217 (C terminal).
    Sequence:

    ALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV


    Database link: O95484

  • Positive control

    • A549, mouse RAW 264.7 and rat PC12 whole cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.1% Sodium azide
    Constituents: 50% Glycerol, 49% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab192398 was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogen and the purity is > 95% (by SDS-PAGE).
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab192398 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 23 kDa.

Target

References

This product has been referenced in:

  • Zhang X  et al. Differences in the expression profiles of claudin proteins in human nasopharyngeal carcinoma compared with non-neoplastic mucosa. Diagn Pathol 13:11 (2018). Read more (PubMed: 29402318) »
  • Yang L  et al. Differences in the expression profiles of claudin proteins in human gastric carcinoma compared with non-neoplastic mucosa. Mol Med Rep 18:1271-1278 (2018). Read more (PubMed: 29901188) »
See all 2 Publications for this product

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Human Tissue sections (Peritoneal mesothelium)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: Tris pH 9
Permeabilization
No
Specification
Peritoneal mesothelium
Blocking step
Serum as blocking agent for 10 minute(s) · Concentration: 10% · Temperature: 20°C
Fixative
Formaldehyde

Ms. Regina Engelhardt

Verified customer

Submitted Mar 21 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up