Overview

  • Product name

    Anti-Claudin 9 antibody [YD4E9]
    See all Claudin 9 primary antibodies
  • Description

    Rat monoclonal [YD4E9] to Claudin 9
  • Host species

    Rat
  • Tested applications

    Suitable for: Competitive ELISA, Flow Cytmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein corresponding to Human Claudin 9 aa 1-217.
    Sequence:

    MASTGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGL WMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLLALLGLLVAIT GAQCTTCVEDEGAKARIVLTAGVILLLAGILVLIPVCWTAHAIIQDFYNP LVAEALKRELGASLYLGWAAAALLMLGGGLLCCTCPPPQVERPRGPRLGY SIPSRSGASGLDKRDYV


    Database link: O95484

  • Positive control

    • BOSC23 expressing Claudin 9 cDNA and native Claudin 9 expressed in mammalian cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Constituent: 100% PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Monoclonal
  • Clone number

    YD4E9
  • Isotype

    IgG2b
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab187116 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
Competitive ELISA 1/200 - 1/400.
Flow Cyt Use 1.2µg for 106 cells.

ab18536 - Rat monoclonal IgG2b, is suitable for use as an isotype control with this antibody.

 

Target

Images

  • Flow cytometry analysis of BOSC23 cells transiently transfected with an expression vector encoding either Claudin 9 (red curve) or a control transfectant; using ab187116 at 1.2 µg/106 cells. PE-conjugated secondary antibodies were used for the analysis.

References

ab187116 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Flow Cytometry
Sample
Human Cell (Human CLDN9 overexpression)
Permeabilization
No
Gating Strategy
Singlets in viable cells
Specification
Human CLDN9 overexpression
Preparation
Cell harvesting/tissue preparation method: Cells deteched with EDTA without trypsin
Sample buffer: 2% FBS in PBS
Fixation
NO Fixation

Abcam user community

Verified customer

Submitted Feb 02 2017

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up