Overview

  • Product name

  • Description

    Rabbit polyclonal to ClC-5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Guinea pig, Pig
  • Immunogen

    Recombinant fragment corresponding to Human ClC-5 aa 62-363.
    Sequence:

    VFAPYACGSGIPEIKTILSGFIIRGYLGKWTLVIKTITLVLAVSSGLSLG KEGPLVHVACCCGNILCHCFNKYRKNEAKRREVLSAAAAAGVSVAFGAPI GGVLFSLEEVSYYFPLKTLWRSFFAALVAAFTLRSINPFGNSRLVLFYVE FHTPWHLFELVPFILLGIFGGLWGALFIRTNIAWCRKRKTTQLGKYPVIE VLVVTAITAILAFPNEYTRMSTSELISELFNDYGLLDSSKLCDYENRFNT SKGGELPDRPAGVGVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSM AV


    Database link: NP_000075

  • Positive control

    • A431 whole cell lysate, HepG2 and Raji lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab97482 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/3000. Predicted molecular weight: 83 kDa.

Target

  • Function

    Proton-coupled chloride transporter. Functions as antiport system and exchanges chloride ions against protons. Important for normal acidification of the endosome lumen. May play an important role in renal tubular function.
  • Tissue specificity

    Kidney. Moderately expressed in aortic vascular smooth muscle and endothelial cells, and at a slightly higher level in the coronary vascular smooth muscle.
  • Involvement in disease

    Hypophosphatemic rickets, X-linked recessive
    Nephrolithiasis 2
    Nephrolithiasis 1
    Low molecular weight proteinuria with hypercalciuria and nephrocalcinosis
  • Sequence similarities

    Belongs to the chloride channel (TC 2.A.49) family. ClC-5/CLCN5 subfamily.
    Contains 2 CBS domains.
  • Post-translational
    modifications

    Ubiquitinated by NEDD4L in the presence of albumin; which promotes endocytosis and proteasomal degradation.
  • Cellular localization

    Golgi apparatus membrane. Endosome membrane. Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Chloride Channel 5 antibody
    • Chloride channel protein 5 antibody
    • Chloride channel voltage sensitive 5 antibody
    • Chloride transporter ClC-5 antibody
    • ClC-5 antibody
    • CLC5 antibody
    • CLCK2 antibody
    • CLCN5 antibody
    • CLCN5_HUMAN antibody
    • DENTS antibody
    • H(+)/Cl(-) exchange transporter 5 antibody
    • hCIC-K2 antibody
    • NPHL1 antibody
    • NPHL2 antibody
    • Voltage gated chloride ion channel CLCN5 antibody
    • XLRH antibody
    • XRN antibody
    see all

Images

  • Anti-ClC-5 antibody (ab97482) at 1/500 dilution + A431 whole cell lysate at 30 µg

    Predicted band size: 83 kDa



    7.5% SDS PAGE

References

ab97482 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

1-2 of 2 Abreviews or Q&A

Application
Immunocytochemistry/ Immunofluorescence
Sample
Pig Cell (LLCPK1)
Permeabilization
Yes - 0.3% Triton in PBS
Specification
LLCPK1
Blocking step
Serum as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C
Fixative
Formaldehyde

Dr. Sufyan Ali Sayyed

Verified customer

Submitted Oct 05 2016

Abreviews
Application
Western blot
Sample
Pig Cell lysate - whole cell (LLCPK1)
Gel Running Conditions
Reduced Denaturing (7.5)
Loading amount
50 µg
Specification
LLCPK1
Blocking step
Milk as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: RT°C

Dr. Sufyan Ali Sayyed

Verified customer

Submitted Oct 05 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up