Overview

  • Product name

    Anti-CLCC1 antibody
  • Description

    Rabbit polyclonal to CLCC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CLCC1 aa 446-551.
    Sequence:

    DVPDAEAREHPTVVPSHKSPVLDTKPKETGGILGEGTPKESSTESSQSAK PVSGQDTSGNTEGSPAAEKAQLKSEAAGSPDQGSTYSPARGVAGPRGQDP VSSPCG


    Database link: Q96S66-1

  • Positive control

    • WB: COLO320, U-251 MG, HepG2, A549 and HEK-293T whole cell lysates. IHC-P: Human liver cancer and testis tissues. ICC/IF: HeLa cells. IP: HepG2 whole cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237755 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 62 kDa.
IP 1/200 - 1/2000.
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF 1/50 - 1/200.

Target

  • Relevance

    CLCC1 seems to act as a chloride ion channel.
  • Cellular localization

    Membrane; Multi-pass membrane protein Potential. Endoplasmic reticulum. Golgi apparatus. Nucleus.
  • Database links

  • Alternative names

    • Chloride channel CLIC like protein 1 antibody
    • KIAA0761 antibody
    • MCLC antibody
    • Mid 1 related chloride channel 1 antibody
    • Mid 1 related chloride channel protein 1 antibody
    • OTTMUSP00000007700 antibody
    • OTTMUSP00000007701 antibody
    • RP23-217I18.1 antibody
    see all

Images

  • All lanes : Anti-CLCC1 antibody (ab237755) at 1/500 dilution

    Lane 1 : COLO320 whole cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) whole cell lysate
    Lane 3 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate
    Lane 4 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 5 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 62 kDa

  • Paraffin-embedded human liver cancer tissue stained for CLCC1 using ab237755 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • Paraffin-embedded human testis tissue stained for CLCC1 using ab237755 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30 minutes at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized tissue using an HRP conjugated SP system.

  • HeLa (Human epithelial cell line from cervix adenocarcinoma) cells stained for CLCC1 (green) using ab237755 at 1/100 dilution in ICC/IF, followed by an Alexa-Fluor®488 conjugated Goat Anti-Rabbit IgG (H+L).

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubated with the primary antibody overnight at 4°C. Secondary used is an Alexa-Fluor®488-conjugated Goat Anti-Rabbit IgG (H+L). Counterstained with DAPI.

  • CLCC1 was immunoprecipitated from 500 µg HepG2 (Human liver hepatocellular carcinoma cell line) whole cell lysate with ab237755 at 1/200 dilution. 

    Lane 1: Rabbit control IgG IP in HepG2 whole cell lysate.

    Lane 2: ab237751 IP in HepG2 whole cell lysate.

    Lane 3: HepG2 whole cell lysate 20 µg (Input).

    For western blotting, an HRP-conjugated Protein G antibody was used as the secondary antibody at 1/2000 dilution.

References

ab237755 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237755.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up