Overview

  • Product name

  • Description

    Rabbit polyclonal to CLEC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant fragment within Human CLEC1 aa 144-258. The exact sequence is proprietary. (With tag; BC039072).
    Sequence:

    HGDNCYQFYKDSKSWEDCKYFCLSENSTMLKINKQEDLEFAASQSYSEFF YSYWTGLLRPDSGKAWLWMDGTPFTSELFHIIIDVTSPRSRDCVAILNGM IFSKDCKELKRCVCE


    Database link: Q8NC01

  • Positive control

    • Mouse thymus and lung tissue lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.05% Sodium azide
    Constituents: 50% Glycerol, 49% PBS

    Note: PBS without Mg2+ and Ca2+.
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab182632 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 32 kDa.

Target

Images

  • All lanes : Anti-CLEC1 antibody (ab182632) at 1/850 dilution

    Lane 1 : Mouse thymus tissue lysate
    Lane 2 : Mouse lung tissue lysate

    Lysates/proteins at 30 µg per lane.

    Secondary
    All lanes : Goat anti Rabbit IgG - H&L (HRP) at 1/10000 dilution

    Predicted band size: 32 kDa


    Exposure time: 5 minutes

References

ab182632 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182632.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up