Overview

  • Product name

  • Description

    Rabbit polyclonal to CLEC10A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse CLEC10A aa 69-273. Two N-terminal tags, expressed in E.coli.
    Sequence:

    RATLDNTTSKIKAEFQSLDSRADSFEKGISSLKVDVEDHRQELQAGRDLS QKVTSLESTVEKREQALKTDLSDLTDHVQQLRKDLKALTCQLANLKNNGS EVACCPLHWTEHEGSCYWFSESEKSWPEADKYCRLENSHLVVVNSLEEQN FLQNRLANVVSWIGLTDQNGPWRWVDGTDFEKGFKNWAPLQPDNWFGHGL GGGED


    Database link: P49300

  • Positive control

    • WB: Recombinant mouse CLEC10A; Mouse lung, testis and cerebellum tissue lysate; Rat testis tissue lysate. IHC-P: Mouse liver and testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232683 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 35 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Probable role in regulating adaptive and innate immune responses. Binds in a calcium-dependent manner to terminal galactose and N-acetylgalactosamine units, linked to serine or threonine. These sugar moieties are known as Tn-Ag and are expressed in a variety of carcinoma cells.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C type (calcium dependent carbohydrate recognition domain) lectin superfamily member 13 (macrophage derived) antibody
    • C type (calcium dependent carbohydrate recognition domain) lectin superfamily member 14 (macrophage derived) antibody
    • C type lectin domain family 10, member A antibody
    • C type lectin superfamily member 14 antibody
    • C-type lectin domain family 10 member A antibody
    • C-type lectin superfamily member 14 antibody
    • CD301 antibody
    • CD301 antigen antibody
    • CD301A antibody
    • CLC10_HUMAN antibody
    • CLEC10A antibody
    • CLECSF13 antibody
    • CLECSF14 antibody
    • HML antibody
    • HML2 antibody
    • Lectin antibody
    • Macrophage C type lectin antibody
    • MACROPHAGE GALACTOSE-TYPE C-TYPE antibody
    • Macrophage lectin 2 (calcium dependent) antibody
    • Macrophage lectin 2 antibody
    • MGL antibody
    • Mgl1 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded mouse liver tissue stained for CLEC10A using ab232683 at 10μg/ml in immunohistochemical analysis.

  • Formalin-fixed, paraffin-embedded mouse testis tissue stained for CLEC10A using ab232683 at 10μg/ml in immunohistochemical analysis.

  • Anti-CLEC10A antibody (ab232683) at 2 µg/ml + Recombinant mouse CLEC10A protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 35 kDa

  • All lanes : Anti-CLEC10A antibody (ab232683) at 2 µg/ml

    Lane 1 : Mouse lung tissue lysate
    Lane 2 : Mouse testis tissue lysate
    Lane 3 : Mouse cerebellum tissue lysate
    Lane 4 : Rat testis tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 35 kDa

References

ab232683 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232683.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up