Overview

  • Product name

    Anti-CLEC12B antibody
  • Description

    Rabbit polyclonal to CLEC12B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow
  • Immunogen

    Synthetic peptide within Human CLEC12B aa 249-276 (C terminal) conjugated to Keyhole Limpet Haemocyanin (KLH). The exact sequence is proprietary. NCBI Accession No. NP_001123470.1.
    Sequence:

    YFQKGNIYISRCSAEIFWICEKTAAPVKTEDLD


    Database link: Q2HXU8

  • Positive control

    • Human pancreas tissue; K562 cell lysate; Mouse testis tissue lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab211452 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
WB 1/1000. Predicted molecular weight: 32 kDa.

Target

  • Function

    Cell surface receptor that protects target cells against natural killer cell-mediated lysis. Modulates signaling cascades and mediates tyrosine phosphorylation of target MAP kinases.
  • Tissue specificity

    Detected in colon, heart, kidney, liver, lung, mammary gland, ovary, spleen and testis.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Domain

    Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C-type lectin domain family 12 member B antibody
    • CL12B_HUMAN antibody
    • CLEC12B antibody
    • Macrophage antigen H antibody
    • UNQ5782 antibody
    see all

Images

  • Anti-CLEC12B antibody (ab211452) at 1/1000 dilution + K562 cell lysate at 35 µg

    Predicted band size: 32 kDa

  • Anti-CLEC12B antibody (ab211452) at 1/1000 dilution + Mouse testis tissue lysate at 35 µg

    Predicted band size: 32 kDa

  • Immunohistochemical analysis of formalin fixed, paraffin embedded Human pancreas tissue labeling CLEC12B with ab211452 at 1/100 dilution. 

References

ab211452 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab211452.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up