Overview

  • Product name

    Anti-CLEC18A antibody
  • Description

    Rabbit polyclonal to CLEC18A
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant full length protein corresponding to Human CLEC18A aa 27-446. Mature chain lacking the signal peptide.
    Sequence:

    EVWPPQLQEQAPMAGALNRKESFLLLSLHNRLRSWVQPPAADMRRLDWSD SLAQLAQARAALCGTPTPSLASGLWRTLQVGWNMQLLPAGLVSFVEVVSL WFAEGQRYSHAAGECARNATCTHYTQLVWATSSQLGCGRHLCSAGQAAIE AFVCAYSPRGNWEVNGKTIVPYKKGAWCSLCTASVSGCFKAWDHAGGLCE VPRNPCRMSCQNHGRLNISTCHCHCPPGYTGRYCQVRCSLQCVHGRFREE ECSCVCDIGYGGAQCATKVHFPFHTCDLRIDGDCFMVSSEADTYYRARMK CQRKGGVLAQIKSQKVQDILAFYLGRLETTNEVIDSDFETRNFWIGLTYK TAKDSFRWATGEHQAFTSFAFGQPDNHGFGNCVELQASAAFNWNDQRCKT RNRYICQFAQEHISRWGPGS


    Database link: A5D8T8

  • Positive control

    • WB: Mouse stomach lysate. IHC-P: Human stomach and kidney tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab236721 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000 - 1/5000. Predicted molecular weight: 50 kDa.
IHC-P 1/20 - 1/200.

Target

Images

  • Anti-CLEC18A antibody (ab236721) at 1/1000 dilution + Mouse stomach lysate

    Secondary
    Goat polyclonal to Ribbit lgG at 1/10000 dilution

    Predicted band size: 50 kDa

  • Paraffin-embedded human stomach tissue stained for CLEC18A using ab236721 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for CLEC18A using ab236721 at 1/100 dilution in immunohistochemical analysis.

References

ab236721 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236721.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up