Overview

  • Product name

  • Description

    Rabbit polyclonal to CLIC2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CLIC2 aa 53-247.
    Sequence:

    DMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHL SPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNT PLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKKYRD FDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS


    Database link: O15247

  • Positive control

    • IHC-P: Human skeletal muscle tissue. ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238816 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Function

    Can insert into membranes and form chloride ion channels. Channel activity depends on the pH. Membrane insertion seems to be redox-regulated and may occur only under oxydizing conditions. Modulates the activity of RYR2 and inhibits calcium influx.
  • Tissue specificity

    Detected in adult brain, heart, liver, lung, spleen, stomach and testis. Expressed in fetal liver and adult skeletal muscle.
  • Sequence similarities

    Belongs to the chloride channel CLIC family.
    Contains 1 GST C-terminal domain.
  • Domain

    Members of this family may change from a globular, soluble state to a state where the N-terminal domain is inserted into the membrane and functions as chloride channel. A conformation change of the N-terminal domain is thought to expose hydrophobic surfaces that trigger membrane insertion.
  • Cellular localization

    Cytoplasm. Membrane. Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • Chloride intracellular channel 2 antibody
    • Chloride intracellular channel protein 2 antibody
    • CLIC 2b antibody
    • CLIC2 antibody
    • CLIC2_HUMAN antibody
    • CLIC2b antibody
    • MRXS32 antibody
    • OTTHUMP00000196471 antibody
    • XAP 121 antibody
    • XAP121 antibody
    see all

Images

  • Paraffin-embedded human skeletal muscle tissue stained for CLIC2 using ab238816 at 1/100 dilution in immunohistochemical analysis.

  • HepG2 (Human liver hepatocellular carcinoma cell line) cells stained for CLIC2 (green) using ab238816 at 1/100 dilution in ICC/IF, followed by Alexa Fluor®488 conjugated Goat Anti-Rabbit IgG (H+L).

References

ab238816 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238816.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up