Overview

  • Product name

  • Description

    Rabbit polyclonal to CLIP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human CLIP2 aa 101-217.
    Sequence:

    TQFAPGQWAGVVLDDPVGKNDGAVGGVRYFECPALQGIFTRPSKLTRQPT AEGSGSDAHSVESLTAQNLSLHSGTATPPLTSRVIPLRESVLNSSVKTGN ESGSNLSDSGSVKRGEK


    Database link: Q9UDT6

  • Positive control

    • ICC/IF: A549 cells.
  • General notes

     This product was previously labelled as CYLN2

     

Properties

Applications

Our Abpromise guarantee covers the use of ab236993 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.

Target

  • Function

    Seems to link microtubules to dendritic lamellar body (DLB), a membranous organelle predominantly present in bulbous dendritic appendages of neurons linked by dendrodendritic gap junctions. May operates in the control of brain-specific organelle translocations.
  • Involvement in disease

    Note=CLIP2 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of CLIP2 may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease.
  • Sequence similarities

    Contains 2 CAP-Gly domains.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton. Associated with the cytoskeleton.
  • Information by UniProt
  • Database links

  • Alternative names

    • CAP GLY domain containing linker protein 2 antibody
    • CAP-Gly domain-containing linker protein 2 antibody
    • CLIP 115 antibody
    • CLIP antibody
    • CLIP-115 antibody
    • Clip2 antibody
    • CLIP2_HUMAN antibody
    • cytoplasmic linker 2 antibody
    • Cytoplasmic linker protein 115 antibody
    • Cytoplasmic linker protein 2 antibody
    • KIAA0291 antibody
    • MGC11333 antibody
    • restin antibody
    • Similar to RESTIN (CYTOPLASMIC LINKER PROTEIN 170 ALPHA 2) antibody
    • WBSCR3 antibody
    • WBSCR4 antibody
    • Williams Beuren syndrome chromosome region 3 antibody
    • Williams Beuren syndrome chromosome region 4 antibody
    • Williams-Beuren syndrome chromosomal region 3 protein antibody
    • Williams-Beuren syndrome chromosomal region 4 protein antibody
    • WSCR3 antibody
    • WSCR4 antibody
    see all

Images

  • A549 (human lung carcinoma cell line) cells stained for CLIP2 using ab236993 (green) at 1/166 dilution in ICC/IF, followed by Alexa Fluor 488-conjugated goat anti-rabbit IgG (H+L). Counterstained with DAPI (blue).

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal goat serum. The cells were then incubate with primary antibody at 4°C overnight.

References

ab236993 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236993.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up