Overview

  • Product name

    Anti-CLIP4 antibody
  • Description

    Rabbit polyclonal to CLIP4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CLIP4 aa 2-60.
    Sequence:

    TIEDLPDFPLEGNPLFGRYPFIFSASDTPVIFSISAAPMPSDCEFSFFDP NDASCQEIL


    Database link: Q8N3C7

  • Positive control

    • IHC-P: Human smooth muscle tissue. WB: Human tonsil lysate. ICC/IF: U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab243532 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB Use a concentration of 0.4 µg/ml. Predicted molecular weight: 76 kDa.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Sequence similarities

    Contains 3 ANK repeats.
    Contains 3 CAP-Gly domains.
  • Information by UniProt
  • Database links

  • Alternative names

    • CAP GLY domain containing linker protein family member 4 antibody
    • CAP-Gly domain-containing linker protein 4 antibody
    • Clip4 antibody
    • CLIP4_HUMAN antibody
    • Restin like 2 antibody
    • Restin-like protein 2 antibody
    • RSNL2 antibody
    see all

Images

  • PFA fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells labeling CLIP4 using ab243532 at 4 µg/ml (green) in ICC/IF. Nuclear probe is visualized in blue, microtublues in red.

  • All lanes : Anti-CLIP4 antibody (ab243532) at 0.4 µg/ml

    Lane 1 : RT4 (Human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (Human brain glioma cell line) cell lysate
    Lane 3 : Human plasma (IgG/HSA depleted)
    Lane 4 : Human liver tissue
    Lane 5 : Human tonsil tissue

    Predicted band size: 76 kDa

  • Formalin-fixed, paraffin-embedded human smooth muscle tissue stained for CLIP4 with ab243532 at 1/20 dilution in immunohistochemical analysis.

References

ab243532 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab243532.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up