Overview

  • Product name

    Anti-CLNS1A/CLCI antibody - C-terminal
    See all CLNS1A/CLCI primary antibodies
  • Description

    Rabbit polyclonal to CLNS1A/CLCI - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IP, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat, Sheep, Rabbit, Goat, Horse, Cow, Dog, Pig, Xenopus laevis, Chinese hamster, Orangutan
  • Immunogen

    Synthetic peptide within Human CLNS1A/CLCI aa 187-237 (C terminal). The exact sequence is proprietary. (NP_001284.1).
    Sequence:

    RLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVD H


    Database link: P54105

  • Positive control

    • HeLa, 293T, Jurkat, TCMK-1 and NIH3T3 whole cell lysates.
  • General notes

     This product was previously labelled as CLNS1A

     

Properties

Applications

Our Abpromise guarantee covers the use of ab192907 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000 - 1/1000. Predicted molecular weight: 26 kDa.
IP Use at 2-10 µg/mg of lysate.
IHC-P 1/1000 - 1/5000.
IF 1/500 - 1/2500.

Target

Images

  • ab192907 staining CLNS1A/CLCI in mouse tetratoma tissue sections. Primary antibody was used at a dilution of 1/1000. 

    Counterstain: Hematoxylin (blue).

  • ab192907 staining CLNS1A/CLCI in human ovarian carcinoma tissue sections. Primary antibody used at a dilution of 1/1000.

    Counterstain: Hematoxylin (blue).

  • All lanes : Anti-CLNS1A/CLCI antibody - C-terminal (ab192907) at 0.1 µg/ml

    Lane 1 : HeLa whole cell lysate
    Lane 2 : 293T whole cell lysate
    Lane 3 : Jurkat whole cell lysate
    Lane 4 : TCMK-1 whole cell lysate
    Lane 5 : NIH3T3 whole cell lysate

    Lysates/proteins at 50 µg per lane.

    Developed using the ECL technique.

    Predicted band size: 26 kDa


    Exposure time: 30 seconds


    Lysates prepared using NETN lysis buffer.

  • Detection of CLNS1A/CLCI in immunoprecipitates of 293T whole cell lysate prepared using NETN lysis buffer (1 mg for IP, 20% of IP loaded) using ab192907 at 6 µg/mg lysate for IP (Lane 1) and at 1 µg/ml for subsequent Western blot detection. Lane 2 represents control IgG IP.

    Detection: Chemiluminescence with an exposure time of 30 seconds.

References

ab192907 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192907.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up