Overview

  • Product name

  • Description

    Rabbit polyclonal to CLPTM1L
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human CLPTM1L aa 32-172.
    Sequence:

    YTRPCSGDANCIQPYLARRPKLQLSVYTTTRSHLGAENNIDLVLNVEDFD VESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHDGKQVHLVSPLT TYMVPKPEEINLLTGESDTQQIEAEKKPTSALDEPVSHWRP


    Database link: Q96KA5

  • Positive control

    • IHC-P: Human lung cancer and pancreatic cancer tissues. ICC/IF: A549 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab237620 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF 1/200 - 1/500.

Target

  • Function

    Enhances cisplatin-mediated apoptosis, when overexpressed.
  • Sequence similarities

    Belongs to the CLPTM1 family.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C130052I12Rik antibody
    • Cisplatin resistance related protein 9 antibody
    • Cisplatin resistance related protein CRR9p antibody
    • Cisplatin resistance-related protein 9 antibody
    • Cleft lip and palate transmembrane protein 1 like protein antibody
    • Cleft lip and palate transmembrane protein 1-like protein antibody
    • CLP1L_HUMAN antibody
    • CLPTM1 like antibody
    • CLPTM1 like protein antibody
    • CLPTM1-like protein antibody
    • CLPTM1L antibody
    • CRR9 antibody
    • CRR9p antibody
    • DKFZp666M1010 antibody
    • DKFZp761M2324 antibody
    • FLJ14400 antibody
    • FLJ32533 antibody
    • MGC36304 antibody
    • OTTHUMP00000220655 antibody
    • RGD1307896 antibody
    see all

Images

  • Paraffin-embedded human lung cancer tissue stained for CLPTM1L using ab237620 at 1/800 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human pancreatic tissue stained for CLPTM1L using ab237620 at 1/800 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • A549 (human lung carcinoma cell line) cells stained for CLPTM1L (green) using ab237620 at 1/266 dilution in ICC/IF, followed by Alexa Fluor 488-congugated Goat Anti-Rabbit IgG (H+L) secondary antibody.

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C. Counterstained with DAPI.

References

ab237620 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab237620.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up