Overview

  • Product name

  • Description

    Rabbit polyclonal to CLYBL/CLB
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Rat
  • Immunogen

    Recombinant full length protein corresponding to Human CLYBL/CLB aa 23-340.
    Sequence:

    ASLAADIPRLGYSSSSHHKYIPRRAVLYVPGNDEKKIKKIPSLNVDCAVL DCEDGVAANKKNEARLRIVKTLEDIDLGPTEKCVRVNSVSSGLAEEDLET LLQSRVLPSSLMLPKVESPEEIQWFADKFSFHLKGRKLEQPMNLIPFVET AMGLLNFKAVCEETLKVGPQVGLFLDAVVFGGEDFRASIGATSSKETLDI LYARQKIVVIAKAFGLQAIDLVYIDFRDGAGLLRQSREGAAMGFTGKQVI HPNQIAVVQEQFSPSPEKIKWAEELIAAFKEHQQLGKGAFTFQGSMIDMP LLKQAQNTVTLATSIKEK


    Database link: Q8N0X4

  • Positive control

    • WB: HeLa and NIH/3T3 whole cell lysates. IHC-P: Human liver, kidney and rectum tissues.
  • General notes

     This product was previously labelled as CLYBL

     

Properties

Applications

Our Abpromise guarantee covers the use of ab235434 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 37 kDa.

Target

Images

  • All lanes : Anti-CLYBL/CLB antibody (ab235434) at 1/1000 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : NIH/3T3 (mouse embyro fibroblast cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 37 kDa

  • Paraffin-embedded human liver tissue stained for CLYBL/CLB using ab235434 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human lkidney tissue stained for CLYBL/CLB using ab235434 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human rectum tissue stained for CLYBL/CLB using ab235434 at 1/100 dilution in immunohistochemical analysis.

References

ab235434 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235434.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up