Overview

  • Product name

  • Description

    Rabbit polyclonal to CMT
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Xenopus laevis
  • Immunogen

    Recombinant fragment corresponding to Human CMT aa 174-210.
    Sequence:

    RKAAMFTAGSNFNHVVQNEKSDTHTLVTSGVYAWFRH


    Database link: O60725

  • Positive control

    • CMT overexpression HEK293T lysate; Human stomach, upper tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab205019 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 32 kDa.

Target

  • Function

    Catalyzes the post-translational methylation of isoprenylated C-terminal cysteine residues.
  • Tissue specificity

    Ubiquitously expressed. Expressed at higher levels in the cerebellum and putamen than in other brain regions. Abundant expression seen in the Purkinje cells and pontine neurons.
  • Sequence similarities

    Belongs to the isoprenylcysteine O-methyltransferase family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1700008E11Rik antibody
    • C80758 antibody
    • fcmt antibody
    • Gm13095 antibody
    • HSTE14 antibody
    • Icmt antibody
    • ICMT_HUMAN antibody
    • Isoprenylcysteine carboxylmethyltransferase antibody
    • MGC118506 antibody
    • MGC39955 antibody
    • MGC95322 antibody
    • MST098 antibody
    • MSTP098 antibody
    • OTTMUSG00000010406 antibody
    • pcCMT antibody
    • PCMT antibody
    • PPMT antibody
    • Prenylated protein carboxyl methyltransferase antibody
    • Prenylcysteine carboxyl methyltransferase antibody
    • Protein-S-isoprenylcysteine O-methyltransferase antibody
    • RP23-421E12.4 antibody
    • STE14 antibody
    see all

Images

  • All lanes : Anti-CMT antibody (ab205019) at 1/100 dilution

    Lane 1 : Negative control
    Lane 2 : CMT overexpression HEK293T lysate

    Predicted band size: 32 kDa

  • Immunohistochemical analysis of paraffin-embedded Human stomach, upper tissue labeling CMT with ab205019 at 1/20 dilution.

References

ab205019 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab205019.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up