Overview

  • Product name

    Anti-CMTM5 antibody - N-terminal
  • Description

    Rabbit polyclonal to CMTM5 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CMTM5 aa 1-36 (N terminal).
    Sequence:

    MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGI


    Database link: Q96DZ9

  • Positive control

    • Human cerebral cortex tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab187980 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Tissue specificity

    Highly expressed in the brain.
  • Sequence similarities

    Belongs to the chemokine-like factor family.
    Contains 1 MARVEL domain.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1500005P16Rik antibody
    • 2900052H21Rik antibody
    • Chemokine like factor super family 5 antibody
    • Chemokine like factor super family five variant 4 antibody
    • Chemokine like factor superfamily 5 antibody
    • Chemokine-like factor superfamily member 5 antibody
    • CKLF-like MARVEL transmembrane domain containing 5 antibody
    • CKLF-like MARVEL transmembrane domain-containing protein 5 antibody
    • CKLF5_HUMAN antibody
    • CKLFSF5 antibody
    • CMTM5 antibody
    • FLJ37521 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human cerebral cortex tissue labeling CMTM5 with ab187980 at 1/200 dilution.

References

This product has been referenced in:

  • Xu G & Dang C CMTM5 is downregulated and suppresses tumour growth in hepatocellular carcinoma through regulating PI3K-AKT signalling. Cancer Cell Int 17:113 (2017). Read more (PubMed: 29213215) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab187980.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up