Overview

  • Product name

  • Description

    Rabbit polyclonal to CNDP2/CN2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human CNDP2/CN2 aa 154-249.
    Sequence:

    IPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVCISDNYWLGKKK PCITYGLRGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGS


    Database link: Q96KP4

  • Positive control

    • Human kidney tissue; RT-4, U-251 MG, Human liver and Human tonsil lysates.
  • General notes

     This product was previously labelled as CNDP2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204351 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/2500 - 1/5000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 53 kDa.

Target

  • Function

    Hydrolyzes a variety of dipeptides including L-carnosine but has a strong preference for Cys-Gly. Isoform 2 may be play a role as tumor suppressor in hepatocellular carcinoma (HCC) cells.
  • Tissue specificity

    Isoform 1 is ubiquitously expressed with higher levels in kidney and liver (at protein level). Isoform 2 is expressed in fetal tissues, it is only expressed in adult liver and placental tissues.
  • Sequence similarities

    Belongs to the peptidase M20A family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • 0610010E05Rik antibody
    • C76600 antibody
    • Carnosinase , tissue antibody
    • Carnosinase 2 antibody
    • CN 2 antibody
    • CN2 antibody
    • CNDP 2 antibody
    • CNDP dipeptidase 2 (metallopeptidase M20 family) antibody
    • CNDP dipeptidase 2 antibody
    • CNDP2 antibody
    • CNDP2_HUMAN antibody
    • CPGL antibody
    • Cytosolic non specific dipeptidase antibody
    • Cytosolic non-specific dipeptidase antibody
    • Cytosolic nonspecific dipeptidase antibody
    • Dip-2 antibody
    • FLJ10830 antibody
    • FLJ35544 antibody
    • Glutamate carboxypeptidase like protein 1 antibody
    • Glutamate carboxypeptidase-like protein 1 antibody
    • HsT2298 antibody
    • Nonspecific dipeptidase, cutosolic antibody
    • Pep-1 antibody
    • Pep1 antibody
    • PEPA antibody
    • Peptidase A antibody
    see all

Images

  • All lanes : Anti-CNDP2/CN2 antibody (ab204351) at 1/100 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma lysate
    Lane 4 : Human liver lysate
    Lane 5 : Human tonsil lysate

    Predicted band size: 53 kDa

  • Immunohistochemical analysis of paraffin-embedded Human kidney tissue labeling CNDP2/CN2 with ab204351 at 1/2500 dilution.

References

ab204351 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204351.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up