Overview

  • Product name

    Anti-CNGA4 antibody - N-terminal
  • Description

    Rabbit polyclonal to CNGA4 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human CNGA4 aa 128-177 (N terminal). The exact sequence is proprietary. Isoform 2
    Sequence:

    RIAKLMLYIFVVIHWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQ


    Database link: Q8IV77-2

  • Positive control

    • Human fetal thymus lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab182104 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 48 kDa.

Target

  • Relevance

    Second messenger, cAMP, causes the opening of cation-selective cyclic nucleotide-gated (CNG) channels and depolarization of the neuron (olfactory sensory neurons, OSNs). CNGA4 is the modulatory subunit of this channel which is known to play a central role in the transduction of odorant signals and subsequent adaptation. By accelerating the calcium-mediated negative feedback in olfactory signaling it allows rapid adaptation to odor stimulation and extends its range of odor detection.
  • Cellular localization

    Membrane; Multi-pass membrane protein.
  • Database links

  • Alternative names

    • Cgn2 antibody
    • CNCA2 antibody
    • CNG 4 antibody
    • CNG channel alpha 4 antibody
    • CNG4 antibody
    • CNG5 antibody
    • Cnga4 cyclic nucleotide gated channel alpha 4 antibody
    • CNGB2 antibody
    • Cyclic nucleotide gated cation channel alpha 4 antibody
    • Cyclic nucleotide gated channel alpha 4 antibody
    • Cyclic nucleotide gated channel beta 2 antibody
    • Cyclic nucleotide gated olfactory channel subunit OCNC2 antibody
    • MGC126168 antibody
    • MGC126169 antibody
    • MGC130316 antibody
    • OCNC2 antibody
    • OCNCb antibody
    • OCNCBETA antibody
    see all

Images

  • Anti-CNGA4 antibody - N-terminal (ab182104) at 1 µg/ml + Human fetal thymus lysate at 10 µg

    Predicted band size: 48 kDa

References

ab182104 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab182104.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up