Anti-CNKSR3 antibody (ab234708)
Key features and details
- Rabbit polyclonal to CNKSR3
- Suitable for: WB, ICC/IF
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-CNKSR3 antibody
See all CNKSR3 primary antibodies -
Description
Rabbit polyclonal to CNKSR3 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Rat -
Immunogen
Recombinant fragment corresponding to Human CNKSR3 aa 301-555.
Sequence:PAPLKNLRWKPPLVQTSPPPATTQSPESTMDTSLKKEKSAILDLYIPPPP AVPYSPRDENGSFVYGGSSKCKQPLPGPKGSESPNSFLDQESRRRRFTIA DSDQLPGYSVETNILPTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARP RGHGRKGEDALCRYFSNERIPPIIEESSSPPYRFSRPTTERHLVRGADYI RGSRCYINSDLHSSATIPFQEEGTKKKSGSSATKSSSTEPSLLVSWFTRL KLLTH
Database link: Q6P9H4 -
Positive control
- WB: Mouse spleen lysate. ICC/IF: HepG2 cells.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Constituents: PBS, 50% Glycerol (glycerin, glycerine), 0.03% Proclin 300 -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purity >95%. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab234708 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/200 - 1/2000. Detects a band of approximately 62 kDa (predicted molecular weight: 62 kDa). | |
ICC/IF | 1/50 - 1/200. |
Target
-
Relevance
CNKSR3 belongs to the CNKSR family. It contains 1 CRIC domain, 1 DUF1170 domain, 1 PDZ (DHR) domain and 1 SAM (sterile alpha motif) domain. -
Cellular localization
Cell Membrane and Cytoplasmic -
Database links
- Entrez Gene: 154043 Human
- Entrez Gene: 215748 Mouse
- Entrez Gene: 308113 Rat
- SwissProt: Q6P9H4 Human
- SwissProt: Q8BMA3 Mouse
- SwissProt: Q5SGD7 Rat
-
Alternative names
- CNK homolog protein 3 antibody
- CNK3 antibody
- CNKSR family member 3 antibody
see all
Images
-
HepG2 (human liver hepatocellular carcinoma cell line) cells stained for CNKSR3 (green) using ab234708 at 1/100 dilution in ICC/IF. Secondary antibody is Alexa Fluor® 488-conjugated Goat Anti-Rabbit IgG (H+L).
-
Anti-CNKSR3 antibody (ab234708) at 1/200 dilution + Mouse spleen lysate
Secondary
Goat polyclonal to rabbit IgG at 1/50000 dilution
Predicted band size: 62 kDa
Observed band size: 62 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab234708 has not yet been referenced specifically in any publications.