Anti-CNNM1 antibody (ab122648)
Key features and details
- Rabbit polyclonal to CNNM1
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-CNNM1 antibody -
Description
Rabbit polyclonal to CNNM1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
antigen sequence:TACHMDSSPQSPDMEAFTDGDSTKAPTTRGTPQTPKDDPAI TLLNNRNSLPCSRSDGLRS PSEVVYLRMEELAFTQEEMTDFEEHSTQQLT, corresponding to amino acids 791-881 of Human CNNM1 Isoform 1 (Q9NRU3).
-
Positive control
- Human testis tissue Human plasma tissue Human liver tissue lysate Human tonsil tissue lysate RT 4 cell line lysate U 251 MG cell line lysate
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at -20ºC. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab122648 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF | Use a concentration of 1 - 4 µg/ml. Recommend PFA Fixation and Triton X-100 treatment |
|
WB | 1/250 - 1/500. | |
IHC-P | 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Probable metal transporter. -
Tissue specificity
Restricted to brain and testis. -
Sequence similarities
Belongs to the ACDP family.
Contains 2 CBS domains. -
Cellular localization
Cell membrane. - Information by UniProt
-
Database links
- Entrez Gene: 26507 Human
- Omim: 607802 Human
- SwissProt: Q9NRU3 Human
- Unigene: 274579 Human
-
Alternative names
- ACDP1 antibody
- Ancient conserved domain protein 1 antibody
- Ancient conserved domain-containing protein 1 antibody
see all
Images
-
Immunofluorescent staining of Human cell line A-431 shows positivity in nucleus but not nucleoli, plasma membrane and cytoplasm. Recommended concentration of ab122648 1-4 µg/ml. Cells treated with PFA/Triton X-100.
-
All lanes : Anti-CNNM1 antibody (ab122648) at 1/250 dilution
Lane 1 : RT 4 cell line lysate
Lane 2 : U 251 MG cell line lysate
Lane 3 : Human plasma
Lane 4 : Human liver tissue lysate
Lane 5 : Human tonsil tissue lysate -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CNNM1 antibody (ab122648)ab122648, at 1/1000, staining CNNM1 in paraffin embedded Human testis by Immunohistochemistry.
Protocols
Datasheets and documents
References (1)
ab122648 has been referenced in 1 publication.
- Xie Y et al. SNHG7 Facilitates Hepatocellular Carcinoma Occurrence by Sequestering miR-9-5p to Upregulate CNNM1 Expression. Cancer Biother Radiopharm N/A:N/A (2020). PubMed: 32397799