Overview

  • Product name

  • Description

    Rabbit polyclonal to CNNM4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human CNNM4 aa 636-765.
    Sequence:

    FSYYGTMALTSVPSDRSPAHPTPLSRSASLSYPDRTDVSTAATLAGSSNQ FGSSVLGQYISDFSVRALVDLQYIKITRQQYQNGLLASRMENSPQFPIDG CTTHMENLAEKSELPVVDETTTLLNERNSL


    Database link: Q6P4Q7

  • Positive control

    • IHC-P: Human appendix tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224401 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Probable metal transporter. The interaction with the metal ion chaperone COX11 suggests that it may play a role in sensory neuron functions (By similarity). May play a role in biomineralization and retinal function.
  • Tissue specificity

    Widely expressed. Highly expressed in heart.
  • Involvement in disease

    Defects in CNNM4 are the cause of Jalili syndrome (JALIS) [MIM:217080]. A syndrome characterized by the association of cone-rod dystrophy and amelogenesis imperfecta.
  • Sequence similarities

    Belongs to the ACDP family.
    Contains 2 CBS domains.
    Contains 1 DUF21 domain.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 430430O18Rik antibody
    • ACDP4 antibody
    • Ancient conserved domain protein 4 antibody
    • Ancient conserved domain-containing protein 4 antibody
    • cnnm4 antibody
    • CNNM4_HUMAN antibody
    • Cyclin and CBS domain divalent metal cation transport mediator 4 antibody
    • Cyclin M4 antibody
    • Cyclin-M4 antibody
    • FLJ42791 antibody
    • KIAA1592 antibody
    • Metal transporter CNNM4 antibody
    see all

Images

  • Paraffin-embedded human appendix tissue stained for CNNM4 using ab224401 at 1/200 dilution in immunohistochemical analysis.

References

ab224401 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224401.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up