Overview

  • Product name

  • Description

    Rabbit polyclonal to CNOT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human CNOT2 aa 217-292.
    Sequence:

    DGSENVTGLDLSDFPALADRNRREGSGNPTPLINPLAGRAPYVGMVTKPA NEQSQDFSIHNEDFPALPGSSYKDPT


    Database link: Q9NZN8

  • Positive control

    • ICC/IF: U-2 OS cells. IHC-P: Human fallopian tube tissue. WB: RT4 and U-251 MG cell lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221711 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/500 - 1/1000. Predicted molecular weight: 60 kDa.
IHC-P 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    The CCR4-NOT complex functions as general transcription regulation complex.
  • Tissue specificity

    Ubiquitous. Highly expressed in brain, heart, thymus, spleen, kidney, liver, small intestine, placenta, lung and peripheral blood leukocytes.
  • Sequence similarities

    Belongs to the CNOT2/3/5 family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CCR4 associated factor 2 antibody
    • CCR4 NOT transcription complex subunit 2 antibody
    • CCR4-associated factor 2 antibody
    • CCR4-NOT transcription complex subunit 2 antibody
    • CDC36 antibody
    • CNOT2 antibody
    • CNOT2_HUMAN antibody
    • HSPC131 antibody
    • MSTP046 antibody
    • Negative regulator of transcription 2 antibody
    • NOT2 (negative regulator of transcription 2 yeast) homolog antibody
    • NOT2 antibody
    • NOT2H antibody
    see all

Images

  • All lanes : Anti-CNOT2 antibody (ab221711) at 1/500 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate

    Predicted band size: 60 kDa

  • Paraffin-embedded human fallopian tube tissue stained for CNOT2 using ab221711 at 1/1000 dilution in immunohistochemical analysis.

  • PFA-fixed, Triton X-100 permeabilized U-2 OS (human bone osteosarcoma epithelial cell line) cells stained for CNOT2 (green) using ab221711 at 4 µg/ml in ICC/IF. 

References

ab221711 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221711.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up