Anti-CNOT4 antibody (ab214937)
Key features and details
- Rabbit polyclonal to CNOT4
- Suitable for: WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-CNOT4 antibody -
Description
Rabbit polyclonal to CNOT4 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human CNOT4 aa 331-476.
Sequence:TESQSLFSDNFRHPNPIPSGLPPFPSSPQTSSDWPTAPEPQSLFTSETIP VSSSTDWQAAFGFGSSKQPEDDLGFDPFDVTRKALADLIEKELSVQDQPS LSPTSLQNSSSHTTTAKGPGSGFLHPAAATNANSLNSTFSVLPQRF
Database link: O95628 -
Positive control
- WB: Human cell line SiHa. IHC-P: Human testis tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
Our Abpromise guarantee covers the use of ab214937 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 63 kDa. | |
IHC-P | 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Has E3 ubiquitin ligase activity. The CCR4-NOT complex functions as general transcription regulation complex. -
Pathway
Protein modification; protein ubiquitination. -
Sequence similarities
Contains 1 C3H1-type zinc finger.
Contains 1 RING-type zinc finger.
Contains 1 RRM (RNA recognition motif) domain. -
Post-translational
modificationsAutoubiquitinated.
Phosphorylated upon DNA damage, probably by ATM or ATR. -
Cellular localization
Cytoplasm. Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 4850 Human
- Omim: 604911 Human
- SwissProt: O95628 Human
- Unigene: 490224 Human
-
Alternative names
- CCR4 NOT transcription complex subunit 4 antibody
- CCR4-associated factor 4 antibody
- CCR4-NOT transcription complex subunit 4 antibody
see all
Images
-
Anti-CNOT4 antibody (ab214937) at 1/50 dilution + Human cell line SiHa
Predicted band size: 63 kDa -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-CNOT4 antibody (ab214937)
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human testis tissue labeling CNOT4 with ab214937 at 1/50 dilution.
Protocols
Datasheets and documents
References (0)
ab214937 has not yet been referenced specifically in any publications.