Overview

  • Product name

    Anti-CNPY2/MSAP antibody
  • Description

    Rabbit polyclonal to CNPY2/MSAP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human CNPY2/MSAP aa 21-182. Mature chain. Expressed in E.coli.
    Sequence:

    RRSQDLHCGACRALVDELEWEIAQVDPKKTIQMGSFRINPDGSQSVVEVP YARSEAHLTELLEEICDRMKEYGEQIDPSTHRKNYVRVVGRNGESSELDL QGIRIDSDISGTLKFACESIVEEYEDELIEFFSREADNVKDKLCSKRTDL CDHALHISHDEL


    Database link: Q9Y2B0

  • Positive control

    • WB: Recombinant human CNPY2/MSAP protein; Pig liver and pancreas lysates; MCF7, HeLa and HepG2 cell lysates. IHC-P: Human liver tissue.
  • General notes

     This product was previously labelled as CNPY2

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233136 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 21 kDa.

Target

  • Function

    Positive regulator of neurite outgrowth by stabilizing myosin regulatory light chain (MRLC). It prevents MIR-mediated MRLC ubiquitination and its subsequent proteasomal degradation.
  • Tissue specificity

    Expressed in different tissues. Highest levels are detected in adult placenta, liver and pancreas.
  • Sequence similarities

    Belongs to the canopy family.
    Contains 1 saposin B-type domain.
  • Cellular localization

    Endoplasmic reticulum.
  • Information by UniProt
  • Database links

  • Alternative names

    • Canopy 2 homolog (zebrafish) antibody
    • Cnpy2 antibody
    • CNPY2_HUMAN antibody
    • MIR-interacting saposin-like protein antibody
    • MSAP antibody
    • Protein canopy homolog 2 antibody
    • Putative secreted protein ZSIG9 antibody
    • TMEM4 antibody
    • Transmembrane protein 4 antibody
    • UNQ1943/PRO4426 antibody
    • ZSIG9 antibody
    see all

Images

  • Anti-CNPY2/MSAP antibody (ab233136) at 2 µg/ml + Recombinant human CNPY2/MSAP protein

    Predicted band size: 21 kDa

  • Anti-CNPY2/MSAP antibody (ab233136) at 2 µg/ml + Pig liver lysate

    Predicted band size: 21 kDa

  • Anti-CNPY2/MSAP antibody (ab233136) at 2 µg + Pig pancreas lysate

    Predicted band size: 21 kDa

  • Anti-CNPY2/MSAP antibody (ab233136) at 2 µg/ml + MCF7 (human breast adenocarcinoma cell line) cell lysate

    Predicted band size: 21 kDa

  • Anti-CNPY2/MSAP antibody (ab233136) at 2 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) cell lysate

    Predicted band size: 21 kDa

  • Anti-CNPY2/MSAP antibody (ab233136) at 2 µg/ml + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate

    Predicted band size: 21 kDa

  • Formalin-fixed, paraffin-embedded human liver tissue stained for CNPY2/MSAP using ab233136 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

This product has been referenced in:

  • Wang D  et al. Canopy Homolog 2 Expression Predicts Poor Prognosis in Hepatocellular Carcinoma with Tumor Hemorrhage. Cell Physiol Biochem 50:2017-2028 (2018). Read more (PubMed: 30415246) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233136.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up