Overview

  • Product name

    Anti-CNTD2 antibody - N-terminal
    See all CNTD2 primary antibodies
  • Description

    Rabbit polyclonal to CNTD2 - N-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rat, Rabbit, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide within Human CNTD2 aa 45-94 (N terminal). The exact sequence is proprietary.
    Sequence:

    PDGFPAGPTVSPRRLARPPGLEEALSALGLQGEREYAGDIFAEVMEYLGL


    Database link: Q9H8S5-2

  • Positive control

    • HepG2 whole cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab179781 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 17 kDa.

Target

Images

  • Anti-CNTD2 antibody - N-terminal (ab179781) at 1 µg/ml + HepG2 whole cell lysate at 10 µg

    Predicted band size: 17 kDa

References

This product has been referenced in:

  • Sánchez-Botet A  et al. The atypical cyclin CNTD2 promotes colon cancer cell proliferation and migration. Sci Rep 8:11797 (2018). Read more (PubMed: 30087414) »
  • Gasa L  et al. A systematic analysis of orphan cyclins reveals CNTD2 as a new oncogenic driver in lung cancer. Sci Rep 7:10228 (2017). Read more (PubMed: 28860486) »
See all 2 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179781.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up