Overview

  • Product name

  • Description

    Rabbit polyclonal to CNTF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Rabbit
  • Immunogen

    Recombinant full length protein corresponding to Human CNTF aa 2-200. E. coli-derived.
    Sequence:

    AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLD SADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPT EGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGL FEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM


    Database link: P26441

  • Positive control

    • Rat brain, Human intestinal cancer and Human lung cancer tissues; Recombinant Human CNTF Protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab190985 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.1 - 0.5 µg/ml. Predicted molecular weight: 23 kDa.
IHC-P Use a concentration of 0.5 - 1 µg/ml. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    CNTF is a survival factor for various neuronal cell types. Seems to prevent the degeneration of motor axons after axotomy.
  • Tissue specificity

    Nervous system.
  • Sequence similarities

    Belongs to the CNTF family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt
  • Database links

  • Alternative names

    • Ciliary neurotrophic factor antibody
    • CNTF antibody
    • CNTF_HUMAN antibody
    • HCNTF antibody

Images

  • Anti-CNTF antibody (ab190985) at 0.5 µg/ml + Recombinant Human CNTF Protein at 0.0005 µg

    Predicted band size: 23 kDa

  • Immunohistochemical analysis of paraffin-embedded Human lung cancer tissue labeling CNTF with ab190985.

  • Immunohistochemical analysis of fparaffin-embedded Human intestinal cancer tissue labeling CNTF with ab190985.

References

This product has been referenced in:

  • Nie J  et al. Dendrobium alkaloids prevent Aß25-35-induced neuronal and synaptic loss via promoting neurotrophic factors expression in mice. PeerJ 4:e2739 (2016). Read more (PubMed: 27994964) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190985.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up