Overview

  • Product name

  • Description

    Rabbit polyclonal to CNTFR
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Human CNTFR aa 160-210 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    LKNRCHIRYMHLFSTIKYKVSISVSNALGHNATAITFDEFTIVKPDPPEN V


    Database link: P26992

  • Positive control

    • Rat muscle tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 50% Glycerol, 0.01% BSA

    Aqueous buffered solution.
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab203024 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

(or 1/50 - 1/200 using a fluorescent secondary antibody).

Target

  • Function

    Binds to CNTF. The alpha subunit provides the receptor specificity.
  • Tissue specificity

    Nervous system and skeletal muscle.
  • Sequence similarities

    Belongs to the type I cytokine receptor family. Type 3 subfamily.
    Contains 2 fibronectin type-III domains.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • Domain

    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
  • Cellular localization

    Cell membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Ciliary neurotrophic factor receptor alpha antibody
    • Ciliary neurotrophic factor receptor antibody
    • Ciliary neurotrophic factor receptor subunit alpha antibody
    • CNTF Receptor alpha antibody
    • CNTF receptor subunit alpha antibody
    • CNTFR Alpha antibody
    • CNTFR antibody
    • CNTFR-alpha antibody
    • CNTFR_HUMAN antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin embedded rat muscle tissue labelling CNTFR with ab203024 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab203024 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab203024.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up