Overview

  • Product name

  • Description

    Rabbit polyclonal to COG4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human COG4 aa 506-785.
    Sequence:

    FQDIQRGVTSAVNIMHSSLQQGKFDTKGIESTDEAKMSFLVTLNNVEVCS ENISTLKKTLESDCTKLFSQGIGGEQAQAKFDSCLSDLAAVSNKFRDLLQ EGLTELNSTAIKPQVQPWINSFFSVSHNIEEEEFNDYEANDPWVQQFILN LEQQMAEFKASLSPVIYDSLTGLMTSLVAVELEKVVLKSTFNRLGGLQFD KELRSLIAYLTTVTTWTIRDKFARLSQMATILNLERVTEILDYWGPNSGP LTWRLTPAEVRQVLALRIDFRSEDIKRLRL


    Database link: Q9H9E3

  • Positive control

    • IHC-P: Human kidney tissue. ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab229811 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/20 - 1/200.

Target

  • Relevance

    COG4 is a component of the conserved oligomeric Golgi (COG) complex which is composed of eight different subunits and is required for normal Golgi morphology and localization. COG4 is required for normal Golgi function.
  • Cellular localization

    Golgi apparatus membrane; Peripheral membrane protein; Cytoplasmic side.
  • Database links

  • Alternative names

    • CDG2J antibody
    • COD1 antibody
    • COG 4 antibody
    • COG complex subunit 4 antibody
    • Complexed with Dor1p antibody
    • Component of oligomeric golgi complex 4 antibody
    • Conserved oligomeric Golgi complex protein 4 antibody
    • Conserved oligomeric Golgi complex subunit 4 antibody
    • DKFZp586E1519 antibody
    see all

Images

  • Paraffin-embedded human kidney tissue stained for COG4 using ab229811 at 1/100 dilution in immunohistochemical analysis.

  • MCF7 (human breast adenocarcinoma cell line) cells stained for COG4 (green) using ab229811 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L).

References

ab229811 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229811.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up