Overview

  • Product name

  • Description

    Rabbit polyclonal to COG4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human COG4 aa 506-785.
    Sequence:

    FQDIQRGVTSAVNIMHSSLQQGKFDTKGIESTDEAKMSFLVTLNNVEVCS ENISTLKKTLESDCTKLFSQGIGGEQAQAKFDSCLSDLAAVSNKFRDLLQ EGLTELNSTAIKPQVQPWINSFFSVSHNIEEEEFNDYEANDPWVQQFILN LEQQMAEFKASLSPVIYDSLTGLMTSLVAVELEKVVLKSTFNRLGGLQFD KELRSLIAYLTTVTTWTIRDKFARLSQMATILNLERVTEILDYWGPNSGP LTWRLTPAEVRQVLALRIDFRSEDIKRLRL


    Database link: Q9H9E3

  • Positive control

    • WB: Mouse liver and gonadal tissue lysates; K562 and HeLa whole cell lysates. IHC-P: Human tonsil and kidney tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab229953 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Predicted molecular weight: 89 kDa.

Target

  • Relevance

    COG4 is a component of the conserved oligomeric Golgi (COG) complex which is composed of eight different subunits and is required for normal Golgi morphology and localization. COG4 is required for normal Golgi function.
  • Cellular localization

    Golgi apparatus membrane; Peripheral membrane protein; Cytoplasmic side.
  • Database links

  • Alternative names

    • CDG2J antibody
    • COD1 antibody
    • COG 4 antibody
    • COG complex subunit 4 antibody
    • Complexed with Dor1p antibody
    • Component of oligomeric golgi complex 4 antibody
    • Conserved oligomeric Golgi complex protein 4 antibody
    • Conserved oligomeric Golgi complex subunit 4 antibody
    • DKFZp586E1519 antibody
    see all

Images

  • All lanes : Anti-COG4 antibody (ab229953) at 1/1000 dilution

    Lane 1 : Mouse liver tissue lysate
    Lane 2 : Mouse gonadal tissue lysate
    Lane 3 : K562 (human chronic myelogenous leukemia cell line from bone marrow) whole cell lysate
    Lane 4 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate

    Secondary
    All lanes : Goat anti-rabbit IgG at 1/10000 dilution

    Predicted band size: 89 kDa
    Observed band size: 89 kDa

  • Paraffin-embedded human tonsil tissue stained for COG4 using ab229953 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for COG4 using ab229953 at 1/100 dilution in immunohistochemical analysis.

References

ab229953 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229953.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up