Overview

  • Product name

  • Description

    Rabbit polyclonal to COG5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
  • Immunogen

    Recombinant fragment corresponding to Human COG5 aa 1-260.
    Sequence:

    MGWVGGRRRDSASPPGRSRSAADDINPAPANMEGGGGSVAVAGLGARGSG AAAATVRELLQDGCYSDFLNEDFDVKTYTSQSIHQAVIAEQLAKLAQGIS QLDRELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGALQGAVDRIKA KIVEPYNKIVARTAQLARLQVACDLLRRIIRILNLSKRLQGQLQGGSREI TKAAQSLNELDYLSQGIDLSGIEVIENDLLFIARARLEVENQAKRLLEQG LETQNPTQVG


    Database link: Q9UP83

  • Positive control

    • WB: Mouse large intestine lysate; A549 and HEK-293T whole cell lysates. IHC-P: Human colon cancer and pancreatic cancer tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.30
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab229830 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 93 kDa (predicted molecular weight: 93 kDa).

Target

  • Relevance

    COG5 belongs to the COG5 family. It is required for normal Golgi function.
  • Cellular localization

    Cytoplasm, cytosol. Golgi apparatus membrane; Peripheral membrane protein
  • Database links

  • Alternative names

    • 13S Golgi transport complex 90 kDa subunit antibody
    • COG complex subunit 5 antibody
    • Component of oligomeric Golgi complex 5 antibody
    • Conserved oligomeric Golgi complex subunit 5 antibody
    • Golgi transport complex 1 antibody
    • GOLTC1 antibody
    • GTC 90 antibody
    • GTC90 antibody
    see all

Images

  • All lanes : Anti-COG5 antibody (ab229830) at 1/1000 dilution

    Lane 1 : Mouse large intestine lysate
    Lane 2 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 3 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size: 93 kDa
    Observed band size: 93 kDa

  • Paraffin-embedded human colon cancer tissue stained for COG5 using ab229830 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreatic cancer tissue stained for COG5 using ab229830 at 1/100 dilution in immunohistochemical analysis.

References

ab229830 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229830.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up