Overview

  • Product name

    Anti-COL16A1 antibody - C-terminal
  • Description

    Rabbit polyclonal to COL16A1 - C-terminal
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human COL16A1 aa 1434-1604 (C terminal).
    Sequence:

    VNYDEIKRFIRQEIIKMFDERMAYYTSRMQFPMEMAAAPGRPGPPGKDGA PGRPGAPGSPGLPGQIGREGRQGLPGVRGLPGTKGEKGDIGIGIAGENGL PGPPGPQGPPGYGKMGATGPMGQQGIPGIPGPPGPMGQPGKAGHCNPSDC FGAMPMEQQYPPMKTMKGPFG


    Database link: Q07092-1

  • Positive control

    • WB: Recombinant human COL16A1 protein; Human serum. IHC-P: Human lung tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231044 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231044 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 158 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Involved in mediating cell attachment and inducing integrin-mediated cellular reactions, such as cell spreading and alterations in cell morphology.
  • Tissue specificity

    In papillary dermis, is a component of specialized fibrillin-1-containing microfibrils, whereas in territorial cartilage matrix, it is localized to a discrete population of thin, weakly banded collagen fibrils in association with other collagens (at protein level). In the placenta, where it is found in the amnion, a membranous tissue lining the amniotic cavity. Within the amnion, it is found in an acellular, relatively dense layer of a complex network of reticular fibers. Also located to a fibroblast layer beneath this dense layer. Exists in tissues in association with other types of collagen.
  • Sequence similarities

    Belongs to the fibril-associated collagens with interrupted helices (FACIT) family.
    Contains 1 TSP N-terminal (TSPN) domain.
  • Developmental stage

    Transiently elevated expression during gestation, and decrease at term.
  • Domain

    This sequence defines eighteen different domains, nine triple-helical domains (COL9 to COL1) and ten non-triple-helical domains (NC10 to NC1). The numerous interruptions in the triple helix may make this molecule either elastic or flexible.
  • Post-translational
    modifications

    Prolines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains.
    Glycosylated.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt
  • Database links

  • Alternative names

    • 447AA antibody
    • Alpha 1 type XVI collagen antibody
    • COGA1_HUMAN antibody
    • Col16a1 antibody
    • Collagen alpha-1(XVI) chain antibody
    • Collagen, type XVI, alpha 1 antibody
    • FP1572 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human lung tissue stained for COL16A1 with ab231044 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-COL16A1 antibody - C-terminal (ab231044) at 3 µg/ml + human serum

    Predicted band size: 158 kDa

  • Anti-COL16A1 antibody - C-terminal (ab231044) at 2 µg/ml + recombinant human COL16A1 protein

    Predicted band size: 158 kDa

References

ab231044 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231044.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up