Overview

  • Product name

    Anti-COL27A1 antibody
  • Description

    Rabbit polyclonal to COL27A1
  • Host species

    Rabbit
  • Specificity

    Isoform 2 of COL27A1.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Sheep, Rabbit, Horse, Chicken, Cow, Cat, Dog, Pig, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide within Human COL27A1 aa 551-600 (internal sequence). The exact sequence is proprietary.
    Sequence:

    LPGPKGDKGSRGDWGLQGPRGPPGPRGRPGPPGPPGGPIQLQQDDLGAAF


    Database link: Q8IZC6-2

  • Positive control

    • Human fetal lung lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab179753 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 83 kDa.

Target

Images

  • Anti-COL27A1 antibody (ab179753) at 1 µg/ml + Human fetal lung lysate at 10 µg

    Predicted band size: 83 kDa

References

ab179753 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab179753.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up