Overview

  • Product name

  • Description

    Rabbit polyclonal to COL4A5
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human, Pig
    Predicted to work with: Dog
  • Immunogen

    Recombinant fragment corresponding to Human COL4A5 aa 1461-1685. Two N-terminal tags, His-tag and S-tag, expressed in E.coli.
    Sequence:

    GFLITRHSQTTDAPQCPQGTLQVYEGFSLLYVQGNKRAHGQDLGTAGSCL RRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMSMQPLKGQSIQPF ISRCAVCEAPAVVIAVHSQTIQIPHCPQGWDSLWIGYSFMMHTSAGAEGS GQALASPGSCLEEFRSAPFIECHGRGTCNYYANSYSFWLATVDVSDMFSK PQSETLKAGDLRTRISRCQVCMKRT


    Database link: P29400

  • Positive control

    • IHC-P: Human kidney tissue. WB: Recombinant human COL4A5 protein; Mouse and pig cerebrum lysates.
  • General notes

     This product was previously labelled as Collagen alpha-5(IV) chain

     

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab231957 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 161 kDa.

Target

  • Function

    Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen.
  • Tissue specificity

    Isoform 2 is found in kidney.
  • Involvement in disease

    Alport syndrome, X-linked
    Deletions covering the N-terminal regions of COL4A5 and COL4A6, which are localized in a head-to-head manner, are found in the chromosome Xq22.3 centromeric deletion syndrome. This results in a phenotype with features of diffuse leiomyomatosis and Alport syndrome (DL-ATS).
  • Sequence similarities

    Belongs to the type IV collagen family.
    Contains 1 collagen IV NC1 (C-terminal non-collagenous) domain.
  • Domain

    Alpha chains of type IV collagen have a non-collagenous domain (NC1) at their C-terminus, frequent interruptions of the G-X-Y repeats in the long central triple-helical domain (which may cause flexibility in the triple helix), and a short N-terminal triple-helical 7S domain.
  • Post-translational
    modifications

    Prolines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains.
    Type IV collagens contain numerous cysteine residues which are involved in inter- and intramolecular disulfide bonding. 12 of these, located in the NC1 domain, are conserved in all known type IV collagens.
    The trimeric structure of the NC1 domains is stabilized by covalent bonds between Lys and Met residues.
  • Cellular localization

    Secreted, extracellular space, extracellular matrix, basement membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • CO4A5_HUMAN antibody
    • COL4A5 antibody
    • Collagen alpha-5(IV) chain antibody

Images

  • Anti-COL4A5 antibody (ab231957) at 2 µg/ml + Pig cerebrum lysate.

    Developed using the ECL technique.

    Predicted band size: 161 kDa

  • Anti-COL4A5 antibody (ab231957) at 2 µg/ml + Mouse cerebrum lysate.

    Developed using the ECL technique.

    Predicted band size: 161 kDa

  • Anti-COL4A5 antibody (ab231957) at 2 µg/ml + Recombinant human COL4A5 protein.

    Developed using the ECL technique.

    Predicted band size: 161 kDa

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for COL4A5 usign ab231957 at 20 µg/mL in immunohistochemical analysis. DAB staining.

References

ab231957 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231957.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up