Overview

  • Product name

  • Description

    Rabbit polyclonal to COL8A1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Chicken
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Rat COL8A1 aa 590-744.
    Sequence:

    GLGIDGVKPPHAYAGKKGKNGGPYEMPAFTAELTVPFPPVGAPVKFDKLL YNGRQNYNPQTGVFTCEVPGVYYFAYHVHCKGGNVWVALFKNNEPMMYTY DEYKKGFLDQASGSAVLLLRPGDRVFLQMPSEQAAGLYAGQYVHSSFSGY LLYPM


    Database link: D4AC70

  • Positive control

    • WB: HeLa cell lysate.
  • General notes

     This product was previously labelled as Collagen VIII alpha 1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab231019 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 74 kDa.

Target

  • Function

    Macromolecular component of the subendothelium. Major component of the Descemet's membrane (basement membrane) of corneal endothelial cells. Also component of the endothelia of blood vessels. Necessary for migration and proliferation of vascular smooth muscle cells and thus, has a potential role in the maintenance of vessel wall integrity and structure, in particular in artherogenesis.
    Vastatin, the C-terminal fragment comprising the NC1 domain, inhibits aortic endothelial cell proliferation and causes cell apoptosis.
  • Tissue specificity

    Expressed primarily in the subendothelium of large blood vessels. Also expressed in arterioles and venules in muscle, heart, kidney, spleen, umbilical cord, liver and lung and is also found in connective tissue layers around hair follicles, around nerve bundles in muscle, in the dura of the optic nerve, in cornea and sclera, and in the perichondrium of cartilaginous tissues. In the kidney, expressed in mesangial cells, glomerular endothelial cells, and tubular epithelial cells. Also expressed in mast cells, and in astrocytes during the repair process. Expressed in Descemet's membrane. Specifically expressed in peritoneal fibroblasts and mesothelial cells.
  • Sequence similarities

    Contains 1 C1q domain.
  • Post-translational
    modifications

    Prolines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains.
    Proteolytically cleaved by neutrophil elastase, in vitro. Proteolytic processing produces the C-terminal NC1 domain fragment, vastatin.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix > basement membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • C3orf7 antibody
    • CO8A1_HUMAN antibody
    • COL8A1 antibody
    • Collagen alpha 1(VIII) chain [Precursor] antibody
    • Endothelial collagen antibody
    • MGC9568 antibody
    • Vastatin antibody
    see all

Images

  • Anti-COL8A1 antibody (ab231019) at 3 µg/ml + HeLa (Human epithelial cell line from cervix adenocarcinoma) cell lysate

    Secondary
    HRP-linked Guinea Pig Anti-Rabbit at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 74 kDa

  • Anti-COL8A1 antibody (ab231019) at 3 µg/ml + recombinant rat Collagen VIII alpha 1 protein

    Secondary
    HRP-linked Guinea Pig Anti-Rabbit at 1/2000 dilution

    Developed using the ECL technique.

    Predicted band size: 74 kDa

References

ab231019 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231019.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up