Overview

  • Product name

  • Description

    Rabbit polyclonal to Collagen IV
  • Host species

    Rabbit
  • Specificity

    ab217147 has 79% cross reactivity with Collagen alpha-5(IV) chain.
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Rabbit
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide within Mouse Collagen IV aa 1430-1480 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    LPGSMGPPGTPSVDHGFLVTRHSQTTDDPLCPPGTKILYHGYSLLYVQGN E


    Database link: P02463

  • Positive control

    • Rat liver and rabbit cartilage tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab217147 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.

Target

  • Function

    Type IV collagen is the major structural component of glomerular basement membranes (GBM), forming a 'chicken-wire' meshwork together with laminins, proteoglycans and entactin/nidogen.
    Arresten, comprising the C-terminal NC1 domain, inhibits angiogenesis and tumor formation. The C-terminal half is found to possess the anti-angiogenic activity. Specifically inhibits endothelial cell proliferation, migration and tube formation. Inhibits expression of hypoxia-inducible factor 1alpha and ERK1/2 and p38 MAPK activation. Ligand for alpha1/beta1 integrin.
  • Tissue specificity

    Highly expressed in placenta.
  • Involvement in disease

    Defects in COL4A1 are a cause of brain small vessel disease with hemorrhage (BSVDH) [MIM:607595]. Brain small vessel diseases underlie 20 to 30 percent of ischemic strokes and a larger proportion of intracerebral hemorrhages. Inheritance is autosomal dominant.
    Defects in COL4A1 are the cause of hereditary angiopathy with nephropathy aneurysms and muscle cramps (HANAC) [MIM:611773]. The clinical renal manifestations include hematuria and bilateral large cysts. Histologic analysis revealed complex basement membrane defects in kidney and skin. The systemic angiopathy appears to affect both small vessels and large arteries.
    Defects in COL4A1 are a cause of porencephaly familial (PCEPH) [MIM:175780]. Porencephaly is a term used for any cavitation or cerebrospinal fluid-filled cyst in the brain. Porencephaly type 1 is usually unilateral and results from focal destructive lesions such as fetal vascular occlusion or birth trauma. Type 2, or schizencephalic porencephaly, is usually symmetric and represents a primary defect or arrest in the development of the cerebral ventricles.
  • Sequence similarities

    Belongs to the type IV collagen family.
    Contains 1 collagen IV NC1 (C-terminal non-collagenous) domain.
  • Domain

    Alpha chains of type IV collagen have a non-collagenous domain (NC1) at their C-terminus, frequent interruptions of the G-X-Y repeats in the long central triple-helical domain (which may cause flexibility in the triple helix), and a short N-terminal triple-helical 7S domain.
  • Post-translational
    modifications

    Lysines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in all cases and bind carbohydrates.
    Prolines at the third position of the tripeptide repeating unit (G-X-Y) are hydroxylated in some or all of the chains.
    Type IV collagens contain numerous cysteine residues which are involved in inter- and intramolecular disulfide bonding. 12 of these, located in the NC1 domain, are conserved in all known type IV collagens.
    The trimeric structure of the NC1 domains is stabilized by covalent bonds between Lys and Met residues.
    Proteolytic processing produces the C-terminal NC1 peptide, arresten.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix > basement membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • Arresten antibody
    • BSVD antibody
    • CO4A1_HUMAN antibody
    • COL4A1 antibody
    • COL4A1 NC1 domain antibody
    • COL4A2 antibody
    • COL4A3 antibody
    • COL4A4 antibody
    • COL4A5 antibody
    • collagen alpha-1(IV) chain antibody
    • Collagen IV Alpha 1 Polypeptide antibody
    • Collagen IV Alpha 2 Polypeptide antibody
    • Collagen Of Basement Membrane Alpha 1 Chain antibody
    • Collagen Of Basement Membrane Alpha 2 Chain antibody
    • Collagen Type IV Alpha 1 antibody
    • collagen type IV alpha 1 chain antibody
    • Collagen Type IV Alpha 2 antibody
    • Collagen Type IV Alpha 3 antibody
    • Collagen Type IV Alpha 4 antibody
    • Collagen Type IV Alpha 5 antibody
    • RATOR antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rabbit cartilage tissue labeling Collagen IV with ab217147 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded rat liver tissue labeling Collagen IV with ab217147 at 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab217147 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217147.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up