Overview

  • Product name

    Anti-Collagen XVII antibody
    See all Collagen XVII primary antibodies
  • Description

    Rabbit polyclonal to Collagen XVII
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Hamster, Cow, Dog
  • Immunogen

    Recombinant fragment corresponding to Human Collagen XVII aa 215-304.
    Sequence:

    NLPSHVWSSTLPAGSSMGTYHNNMTTQSSSLLNTNAYSAGSVFGVPNNMA SCSPTLHPGLSTSSSVFGMQNNLAPSLTTLSHGTTTTSTA


    Database link: Q9UMD9

  • Positive control

    • Human colon tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab204056 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Unlike most collagens, collagen XVII is a transmembrane protein. Collagen XVII is a structural component of hemidesmosomes, multiprotein complexes at the dermal epidermal basement membrane zone that mediate adhesion of keratinocytes to the underlying membrane. Mutations in the gene coding for collagen XVII are associated with both generalized atrophic benign and junctional epidermolysis bullosa. Two homotrimeric forms of type XVII collagen exist. The full length form is the transmembrane protein. A soluble form, referred to as either ectodomain or LAD 1, is generated by proteolytic processing of the full length form. Two transcript variants, one resulting from alternative splicing in the 3' UTR, have been identified for this gene.
  • Cellular localization

    Cell junction, hemidesmosome. Membrane; Single-pass type II membrane protein. Note=Localized along the plasma membrane of the hemidesmosome. 120 kDa linear IgA disease antigen and 97 kDa linear IgA disease antigen: Secreted, extracellular space, extracellular matrix, basement membrane.
  • Database links

  • Alternative names

    • 180 kDa bullous pemphigoid antigen 2 antibody
    • Alpha 1 type XVII collagen antibody
    • BA16H23.2 antibody
    • BP 180 antibody
    • BP180 antibody
    • BPA 2 antibody
    • BPAG 2 antibody
    • BPAG2 antibody
    • Bullous pemphigoid antigen 2 antibody
    • COL17A1 antibody
    • Collagen 17 antibody
    • Collagen alpha 1 XVII chain antibody
    • Collagen alpha 1(XVII) chain antibody
    • Collagen alpha1 XVII chain antibody
    • Collagen type XVII alpha 1 antibody
    • Collagen XVII alpha 1 polypeptide antibody
    • CollagenXVII antibody
    • Epidermolysis bullosa junctional localisata variant antibody
    • FLJ60881 antibody
    • KIAA0204 antibody
    • LAD 1 antibody
    • LAD1 antibody
    see all

Images

  • Immunohistochemical analysis of paraffin-embedded Human colon tissue labeling Collagen XVII with ab204056 at 1/20 dilution.

References

ab204056 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Sample
Pig Tissue sections (skin)
Antigen retrieval step
Heat mediated - Buffer/Enzyme Used: tris-HCl EDTA buffer
Permeabilization
Yes - H2O2, TBS, Tween
Specification
skin
Blocking step
BSA as blocking agent for 30 minute(s) · Concentration: 1% · Temperature: RT°C
Fixative
Paraformaldehyde

Lenka Sucha

Verified customer

Submitted Jun 17 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up