Anti-Collagen XVII antibody (ab231939)
Key features and details
- Rabbit polyclonal to Collagen XVII
- Suitable for: IHC-P, WB
- Reacts with: Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-Collagen XVII antibody
See all Collagen XVII primary antibodies -
Description
Rabbit polyclonal to Collagen XVII -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Rat, Human
Predicted to work with: Cow -
Immunogen
Recombinant fragment (His-tag) corresponding to Human Collagen XVII aa 184-375. Expressed in E.coli. N-terminal tag.
Sequence:PIPKKGTVETKIVTASSQSVSGTYDATILDANLPSHVWSSTLPAGSSMGT YHNNMTTQSSSLLNTNAYSAGSVFGVPNNMASCSPTLHPGLSTSSSVFGM QNNLAPSLTTLSHGTTTTSTAYGVKKNMPQSPAAVNTGVSTSAACTTSVQ SDDLLHKDCKFLILEKDNTPAKKEMELLIMTKDSGKVFTASP
Database link: Q9UMD9 -
Positive control
- IHC-P: Human stomach tissue. WB: Rat skin lysate; Recombinant human Collagen XVII protein.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
ab231939 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab231939 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 5 - 20 µg/ml. | |
WB | Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 150 kDa. |
Target
-
Relevance
Unlike most collagens, collagen XVII is a transmembrane protein. Collagen XVII is a structural component of hemidesmosomes, multiprotein complexes at the dermal epidermal basement membrane zone that mediate adhesion of keratinocytes to the underlying membrane. Mutations in the gene coding for collagen XVII are associated with both generalized atrophic benign and junctional epidermolysis bullosa. Two homotrimeric forms of type XVII collagen exist. The full length form is the transmembrane protein. A soluble form, referred to as either ectodomain or LAD 1, is generated by proteolytic processing of the full length form. Two transcript variants, one resulting from alternative splicing in the 3' UTR, have been identified for this gene. -
Cellular localization
Cell junction, hemidesmosome. Membrane; Single-pass type II membrane protein. Note=Localized along the plasma membrane of the hemidesmosome. 120 kDa linear IgA disease antigen and 97 kDa linear IgA disease antigen: Secreted, extracellular space, extracellular matrix, basement membrane. -
Database links
- Entrez Gene: 513804 Cow
- Entrez Gene: 1308 Human
- Entrez Gene: 294027 Rat
- Omim: 113811 Human
- SwissProt: A6QPB3 Cow
- SwissProt: Q9UMD9 Human
- Unigene: 117938 Human
- Unigene: 40392 Rat
-
Alternative names
- 180 kDa bullous pemphigoid antigen 2 antibody
- Alpha 1 type XVII collagen antibody
- BA16H23.2 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-Collagen XVII antibody (ab231939)
Formalin-fixed, paraffin-embedded human stomach tissue stained for Collagen XVII using ab231939 at 20 µg/ml in immunohistochemical analysis. DAB staining.
-
Anti-Collagen XVII antibody (ab231939) at 3 µg/ml + Rat skin lysate
Predicted band size: 150 kDa -
Anti-Collagen XVII antibody (ab231939) at 2 µg/ml + Recombinant human Collagen XVII protein
Predicted band size: 150 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231939 has not yet been referenced specifically in any publications.