Overview

  • Product name

  • Description

    Rabbit polyclonal to COMMD10
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human COMMD10 aa 84-172.
    Sequence:

    YHNVKPAALQQQLENIHLRQDKAEAFVNTWSSMGQETVEKFRQRILAPCK LETVGWQLNLQMAHSAQAKLKSPQAVLQLGVNNEDSKSL


    Database link: Q9Y6G5

  • Positive control

    • ICC/IF: HepG2 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234768 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.

Target

  • Tissue specificity

    Ubiquitous.
  • Sequence similarities

    Contains 1 COMM domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • COMDA_HUMAN antibody
    • COMM domain containing 10 antibody
    • COMM domain-containing protein 10 antibody
    • COMMD 10 antibody
    • commd10 antibody
    • FLJ11285 antibody
    • HGNC:30201 antibody
    • HSPC305 antibody
    • OTTHUMP00000222923 antibody
    • PTD002 antibody
    see all

Images

  • HepG2 (human liver hepatocellular carcinoma cell line) cells stained for COMMD10 (green) using ab234768 at 1/100 dilution in ICC/IF, followed by Alexa Fluor 488® congugated Goat Anti-Rabbit IgG (H+L).

References

ab234768 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234768.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up