Overview

  • Product name

    Anti-COMMD1/MURR1 antibody
    See all COMMD1/MURR1 primary antibodies
  • Description

    Rabbit polyclonal to COMMD1/MURR1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, IP, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human COMMD1/MURR1 aa 1-190.
    Sequence:

    MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRP FLAKMRGILKSIASADMDFNQLEAFLTAQTKKQGGITSDQAAVISKFWKS HKTKIRESLMNQSRWNSGLRGLSWRVDGKSQSRHSAQIHTPVAIIELELG KYGQESEFLCLEFDEVKVNQILKTLSEVEESISTLISQPN


    Database link: Q8N668

  • Positive control

    • WB: A549, Jurkat, MCF7, HeLa and HepG2 whole cell lysate. IP: HepG2 whole cell lysate. IHC-P: Human adrenal gland tissue and liver cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab224727 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
IP 1/200 - 1/2000.
WB 1/1000 - 1/5000. Detects a band of approximately 21 kDa (predicted molecular weight: 22, 18 kDa).

Target

  • Function

    Proposed scaffold protein that is implicated in diverse physiological processes and whose function may be in part linked to its ability to regulate ubiquitination of specific cellular proteins. Can modulate activity of cullin-RING E3 ubiquitin ligase (CRL) complexes by displacing CAND1; in vitro promotes CRL E3 activity and dissociates CAND1 from CUL1 and CUL2 (PubMed:21778237). Promotes ubiquitination of NF-kappa-B subunit RELA and its subsequent proteasomal degradation. Down-regulates NF-kappa-B activity (PubMed:15799966, PubMed:17183367, PubMed:20048074). Involved in the regulation of membrane expression and ubiquitination of SLC12A2 (PubMed:23515529). Modulates Na(+) transport in epithelial cells by regulation of apical cell surface expression of amiloride-sensitive sodium channel (ENaC) subunits and by promoting their ubiquitination presumably involving NEDD4L. Promotes the localization of SCNN1D to recycling endosomes (PubMed:14645214, PubMed:20237237, PubMed:21741370). Promotes CFTR cell surface expression through regulation of its ubiquitination (PubMed:21483833). Down-regulates SOD1 activity by interfering with its homodimerization (PubMed:20595380). Plays a role in copper ion homeostasis. Involved in copper-dependent ATP7A trafficking between the trans-Golgi network and vesicles in the cell periphery; the function is proposed to depend on its association within the CCC complex and cooperation with the WASH complex on early endosomes (PubMed:25355947). Can bind one copper ion per monomer (PubMed:17309234). May function to facilitate biliary copper excretion within hepatocytes. Binds to phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) (PubMed:18940794). Involved in the regulation of HIF1A-mediated transcription; competes with ARNT/Hif-1-beta for binding to HIF1A resulting in decreased DNA binding and impaired transcriptional activation by HIF-1 (PubMed:20458141).
  • Tissue specificity

    Ubiquitous. Highest expression in the liver, with lower expression in brain, lung, placenta, pancreas, small intestine, heart, skeletal muscle, kidney and placenta. Down-regulated in cancer tissues.
  • Sequence similarities

    Contains 1 COMM domain.
  • Post-translational
    modifications

    Acetylated by EP300 ina stimuli-specific manner; protecting it from XIAP-mediated proteasomal degradation and required for interaction with RElA in response to stress.
    Ubiquitinated; undergoes both 'Lys-63'- and 'Lys-48'-linked polyubiquitination. Ubiquitinated by XIAP, leading to its proteasomal degradation.
  • Cellular localization

    Nucleus. Cytoplasm. Endosome membrane. Cytoplasmic vesicle. Early endosome. Recycling endosome. Shuttles between nucleus and cytosol. Detected in perinuclear foci that may be aggresomes containing misfolded, ubiquitinated proteins.
  • Information by UniProt
  • Database links

  • Alternative names

    • C2orf5 antibody
    • COMD1 antibody
    • COMD1_HUMAN antibody
    • COMM domain-containing protein 1 antibody
    • COMMD1 antibody
    • Copper metabolism (Murr1) domain containing 1 antibody
    • Copper metabolism domain containing 1 antibody
    • Copper metabolism gene MURR1 antibody
    • Copper metabolism MURR1 domain-containing protein 1 antibody
    • MGC27155 antibody
    • MURR1 antibody
    • Protein Murr1 antibody
    see all

Images

  • All lanes : Anti-COMMD1/MURR1 antibody (ab224727) at 1/1000 dilution

    Lane 1 : A549 (human lung carcinoma cell line) whole cell lysate
    Lane 2 : Jurkat (human T cell leukemia cell line from peripheral blood) whole cell lysate
    Lane 3 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 4 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 5 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Predicted band size: 22, 18 kDa
    Observed band size: 21 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human liver cancer tissue stained for COMMD1/MURR1 with ab224727 at 1/20 dilution in immunohistochemical analysis.

  • COMMD1/MURR1 was immunoprecipitated from 0.5 mg of HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate with ab224727 at 1/200 dilution. Western blot was performed from the immunoprecipitate using ab224727 at 1/1000 dilution. HRP-conjugated anti-rabbit IgG, specific to the non-reduced form of IgG, was used as secondary antibody at 1/10000 dilution.

    Lane 1: Rabbit monoclonal IgG instead of ab224727 in HepG2 whole cell lysate.

    Lane 2: ab224727 IP in HepG2 whole cell lysate.

    Lane 3: HepG2 whole cell lysate 20 μg (Input).

  • Paraffin-embedded human adrenal gland tissue stained for COMMD1/MURR1 with ab224727 at 1/20 dilution in immunohistochemical analysis.

References

ab224727 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224727.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up