Anti-COMP antibody (ab171854)
- Datasheet
- References
- Protocols
Overview
-
Product nameAnti-COMP antibody
See all COMP primary antibodies -
DescriptionMouse polyclonal to COMP
-
Host speciesMouse
-
Tested applicationsSuitable for: WBmore details
-
Species reactivityReacts with: Human
Predicted to work with: Mouse, Rat, Cow -
Immunogen
Recombinant full length protein corresponding to Human COMP aa 1-724. This sequence is a synthetic construct corresponding to aa 34-757 fragment of Human COMP according to Swissprot P49747.
Sequence:MLRELQETNAALQDVRELLRQQVREITFLKNTVMECDACGMQQSVRTGLP SVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNA HPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTDINE CETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASGCQRRAQRFCPDGS PSECHEHADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCP ERQCRKDNCVTVPNSGQEDVDRDGIGDACDPDADGDGVPNEKDNCPLVRN PDQRNTDEDKWGDACDNCRSQKNDDQKDTDQDGRGDACDDDIDGDRIRNQ ADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQADVDHDFVGDACDSD QDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDN CRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRA FQTVVLDPEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFE GTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEP GIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKKSYR WFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGRLGVFCFSQENII WANLRYRCNDTIPEDYETHQLRQA
Database link: ABM87644.1 -
Positive control
- COMP-transfected 293T cell lysate.
Properties
-
FormLiquid
-
Storage instructionsShipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
-
Storage bufferpH: 7.2
Constituent: 100% PBS -
Concentration information loading...
-
PurityProtein A purified
-
ClonalityPolyclonal
-
IsotypeIgG
-
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab171854 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | Use a concentration of 1 µg/ml. Predicted molecular weight: 80 kDa. |
Target
-
FunctionMay play a role in the structural integrity of cartilage via its interaction with other extracellular matrix proteins such as the collagens and fibronectin. Can mediate the interaction of chondrocytes with the cartilage extracellular matrix through interaction with cell surface integrin receptors. Could play a role in the pathogenesis of osteoarthritis. Potent suppressor of apoptosis in both primary chondrocytes and transformed cells. Suppresses apoptosis by blocking the activation of caspase-3 and by inducing the IAP family of survival proteins (BIRC3, BIRC2, BIRC5 and XIAP). Essential for maintaining a vascular smooth muscle cells (VSMCs) contractile/differentiated phenotype under physiological and pathological stimuli. Maintains this phenotype of VSMCs by interacting with ITGA7.
-
Tissue specificityAbundantly expressed in the chondrocyte extracellular matrix, and is also found in bone, tendon, ligament and synovium and blood vessels. Increased amounts are produced during late stages of osteoarthritis in the area adjacent to the main defect.
-
Involvement in diseaseDefects in COMP are the cause of multiple epiphyseal dysplasia type 1 (EDM1) [MIM:132400]. EDM is a generalized skeletal dysplasia associated with significant morbidity. Joint pain, joint deformity, waddling gait, and short stature are the main clinical signs and symptoms. EDM is broadly categorized into the more severe Fairbank and the milder Ribbing types.
Defects in COMP are the cause of pseudoachondroplasia (PSACH) [MIM:177170]. PSAC is a dominantly inherited chondrodysplasia characterized by short stature and early-onset osteoarthrosis. PSACH is more severe than EDM1 and is recognized in early childhood. -
Sequence similaritiesBelongs to the thrombospondin family.
Contains 4 EGF-like domains.
Contains 1 TSP C-terminal (TSPC) domain.
Contains 8 TSP type-3 repeats. -
Developmental stagePresent during the earliest stages of limb maturation and is later found in regions where the joints develop.
-
DomainThe cell attachment motif mediates the attachment to chondrocytes. It mediates the induction of both the IAP family of survival proteins and the antiapoptotic response.
The TSP C-terminal domain mediates interaction with FN1 and ACAN. -
Cellular localizationSecreted > extracellular space > extracellular matrix.
- Information by UniProt
-
Database links
- Entrez Gene: 281088 Cow
- Entrez Gene: 1311 Human
- Entrez Gene: 12845 Mouse
- Entrez Gene: 25304 Rat
- Omim: 600310 Human
- SwissProt: P35445 Cow
- SwissProt: P49747 Human
- SwissProt: Q9R0G6 Mouse
see all -
Alternative names
- cartilage oligomeric matrix protein (pseudoachondroplasia, epiphyseal dysplasia 1, multiple) antibody
- Cartilage oligomeric matrix protein antibody
- Cartilage oligomeric matrix protein precursor antibody
see all
Images
-
All lanes : Anti-COMP antibody (ab171854) at 1 µg/ml
Lane 1 : COMP-transfected 293T cell lysate
Lane 2 : Non-transfected 293T cell lysate
Lysates/proteins at 15 µl per lane.
Secondary
All lanes : Goat Anti-Mouse IgG (H+L)-HRP at 1/2500 dilution
Developed using the ECL technique.
Predicted band size: 80 kDa
Protocols
Datasheets and documents
References
ab171854 has not yet been referenced specifically in any publications.